KEGG   Nostoc sp. PCC 7524: Nos7524_3366Help
Entry
Nos7524_3366      CDS       T02363                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nos7524_3366
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Nos7524_3366
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nos7524_3366
Enzymes [BR:nop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Nos7524_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4113038..4114594)
Genome map
AA seq 518 aa AA seqDB search
MEFIGDRLLKRRNFLIGAGFVSGLAVTSQWRPVMAQGRFSDYPFKLGVASGDPLPDSVVL
WTRLAPEPLNGGGMRPVNVPVQWQIARDENMTQVVQKGTVLATPELGHSVHVDVRGLEPH
RWYWYQFKVGNEVSPIGRTRTAPALYSSITQLNFAFASCQDWQNGFYTAYKHMAEEDLDL
VVHLGDYIYEYGPETGAPRQHIGPEIITLDDYRNRYALYRTDVNLQAVHTNFPWVVTWDD
HEVDNNYANVIPEDSQSREAFITRRANAYQAYYEHMPLRLSSLPKKSSMLLYRRFTFGDL
AEFNVLDTRQYRTDQPCGDGLKPLCDAAVDPKATMTGARQEAWLLRGLDKSQARWNVIAQ
QTMLAQFDFDPRPGIGLFNVDQWDGYVAARDRLLRFLEQRQPSNPVVITGDIHSSWVHDL
KADFNNPLSATIGTEFICTSISSDFPTQFIAPVQAALSDNPHTKFFDGANRGYVRCKLTR
DKWQSDYRVVSSILDQNATVSTLASFVVENGQPGAQTA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggaatttataggcgatcgcctgctcaaacggcgtaattttttaataggtgctggattt
gtttcagggttggccgttactagccaatggcgacctgtaatggcgcaaggtagattttct
gactatccatttaagcttggtgtcgcctctggtgatcctctaccggatagtgtggtgtta
tggactcgtctcgcaccagaaccgctcaatggtggcgggatgcgtcctgtaaatgtaccc
gtacaatggcaaattgcacgggatgaaaacatgactcaggttgtacaaaaaggcacagtt
ttggcaacaccagaactgggacactctgtacacgtcgatgtgcggggattagaacctcat
cgttggtactggtatcaatttaaagttggtaatgaagtcagtcctattggccgcactcgt
acagcccctgcactctatagttctattacacagctaaactttgcttttgcctcctgccaa
gattggcaaaacggcttttatacagcctacaaacacatggctgaagaagacttagattta
gttgtgcatttgggtgactacatctacgaatatggccccgaaactggtgcgccacgtcaa
cacatcggcccagaaattattactctagatgactaccgcaaccgttatgcgttgtataga
accgacgtaaatttacaagcggttcatactaacttcccttgggtagttacttgggatgat
catgaggtagataacaactacgccaacgtcataccagaagatagtcaaagtcgcgaagca
tttatcactcgacgagccaatgcttaccaagcatattatgagcatatgccattgcgccta
tcttccttaccaaaaaaatctagtatgctgctgtatcggcggtttactttcggtgattta
gctgagttcaacgtcctagatactcgccagtaccgtacagatcaaccttgtggtgacgga
ctcaaacccctgtgtgatgcggctgtagatcccaaggcgacgatgacaggtgcaagacag
gaagcttggctgttgaggggattagacaaatcacaagcaaggtggaatgtgattgcacaa
caaaccatgctggcgcaatttgattttgatccccgaccagggataggactatttaatgta
gatcagtgggatggttatgttgctgcgcgcgatcgcctgttaagatttttagaacagcgc
caaccttctaacccagtggtgattactggagatattcattccagttgggtacatgattta
aaagctgattttaataatcccctatcagcaaccatcggtactgaatttatttgtacttcc
atttcttctgactttcccacccaatttattgcaccagtgcaagccgcactcagcgataac
ccccatacaaaattctttgatggtgctaaccggggttatgtgcgttgcaaattgactaga
gataagtggcaaagtgattatcgcgttgtttccagtattcttgaccaaaatgctaccgtt
agtaccctagcttcctttgtagtggaaaacggtcaaccaggcgcacaaacagcttaa

DBGET integrated database retrieval system