KEGG   Nostoc sp. PCC 7524: Nos7524_3388Help
Entry
Nos7524_3388      CDS       T02363                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7524_3388
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nos7524_3388
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nos7524_3388
Enzymes [BR:nop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nos7524_3388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4145528..4146832
Genome map
AA seq 434 aa AA seqDB search
MTQAVSTPTKASNAAFSALKCKECGAEYELKASHVCELCFGPLEVKYDYNALRLSVTREK
IQAGPNSIWRYRSFLPVATDNVIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKVLGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHVVAPLASGSLFTKIYKGFQEFVEVGLVEGKQVRFSGAQAEGCSPIAQAFKEDRDFIK
PVKPNTIAKSIAIGNPADGVYAVEIAKKTGGNIESVNDAEIIEGIKLLAETEGIFTETAG
GTTIAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAVQGYIGEPLTIDAKLDSFERALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcagtatccacacctaccaaagccagcaacgccgctttcagtgcattgaaa
tgtaaagaatgtggcgcggaatatgaactcaaagctagtcatgtatgtgaattatgcttt
gggcctttggaagtgaagtatgactacaatgctttgcgtttgtctgtcacccgtgaaaaa
attcaagctgggccgaattccatttggcgttatcgttcctttttgcctgtcgccactgac
aatgtaattgatgtgggaacagggatgactcccttggtgcgttcccatcgtctcgcccgt
cgcctgggtttaaacaaactatatataaagaatgatgcggtaaatatgcccaccctgagc
tttaaggatcgggtggtgtcagttgctctttcccgcgctagagagttgggtttcactaca
gtttcttgcgctagcaccggaaacttggctaactccaccgccgcgatcgcagctcatgcc
ggtttagactgttgtgtattcatcccctcagatttagaagctggcaaagtcttgggtagc
ttgatttacagtcctaccctcatggctgtgaaaggtaactacgaccaagtaaatcgcctc
tgctcggaagttgctaatacacatggttggggttttgtcaatattaatttacgtccctac
tattctgaaggttctaagacattaggctttgaagtagcagaacaactaggttgggaacta
cctgatcatgtagttgcacctttggcttctggttcactattcaccaagatttacaaaggc
ttccaagaatttgtagaagttggtttagtagaaggtaagcaagtccgtttcagtggcgca
caagcagaaggttgttcacccatcgctcaagcatttaaagaagaccgcgactttattaaa
ccagttaaaccgaatacaattgctaaatcaattgcgatcggcaacccagcagatggagtt
tatgccgtagagattgccaagaagactggcggtaatattgaatctgtcaacgatgcagaa
atcatcgaaggcatcaaattgctagctgaaacagaaggtatctttaccgagacagcaggt
ggaactaccattgctgtactgaaaaaattagtagaagctggcaagattgatccagatgaa
actactgtggtttacatcactggcaacggtttgaaaacccaagaagctgtacaaggctac
attggcgaacctttgacaattgatgccaaactcgatagctttgaacgtgcattagagcgt
tctcggactttagatcgcttggaatggcaacaagttcttgtttag

DBGET integrated database retrieval system