KEGG   Nostoc sp. PCC 7524: Nos7524_3523Help
Entry
Nos7524_3523      CDS       T02363                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nop00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:nop00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:nop02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4301779..4303494
Genome map
AA seq 571 aa AA seqDB search
MGKRFSRRNFLKYSLATNIVIWTSEAIARKLNISLKEMQIFDIAAASAPSITTFPQSVSS
GEPQTHGITLWTRIIAKSEVAKVAFEVAADSAFSQVVLQGFANTNSHCDYTVKIPLESNV
LKPYTTYYYRFIFNKAVSPIGRFKTLPSPQDQTLDKIKFAYINCHDYINGYYNAYEFLAK
EDIDFVVFLGDYIYETVNDTTSQREIRSLNLPSGELIASTLEDYRFLYQTYNSDPQLQRL
REKFAFITIWDDHEFANDCFQANAPDQFPFYKPELRQAATQAWAEYTPISIPFSINNKNF
NSLQIYRTFKFGNLLELVLTDERLYRDEPPSCDDSVTQKQRYETRKRYLVSDSPQRNDAH
RTMLGHRQRDWLIKQICNSSCIWKIWGNEVMTMQLKLLSVFATLFLGQKTPDLFINLDQW
DAYPAERTLLFKAIKAAKVKNFVTITGDLHTFVAGYQKLDFDDQSDQPMGVEFVVGSITA
SNLAERINLNSFNLPLPSIETVTTLIQLSNPHICYFNSNTHGYNIVEVTPEALICTFKVV
SNIIKPGGRVSTLKVFRVPRDQVLIEDITPT
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagcgatttagtagacgaaatttcttaaagtattcactagctaccaatattgtt
atatggacaagtgaagcaattgctaggaagctgaatatcagtttaaaggaaatgcaaata
tttgatattgctgctgcctctgcaccttcaataactacatttccacaaagcgtaagctct
ggagagcctcaaactcatggcattactttatggacacgcatcatagctaaatcggaagtt
gctaaagttgcctttgaagtggctgctgattctgcttttagtcaagtagttttacaaggt
tttgctaatactaatagtcattgtgattataccgttaaaattccattagaatcaaatgtt
ctgaaaccttacacaacttattattatcgattcatatttaacaaagctgttagtcctatt
ggtcgttttaaaactttaccatctcctcaagatcagacattagataaaataaaatttgct
tatatcaactgccatgattatattaatggctattataatgcctatgaatttttagcaaaa
gaggatatagattttgttgtatttttaggtgactatatttatgagacggtaaatgatact
acttctcaaagagaaatacgttctctgaatttgcctagtggtgagttaatagcatcaaca
ttagaagattatcgatttctctaccaaacttataattctgatccacagctacaaagactg
cgggaaaaatttgcctttattactatttgggatgatcatgagtttgcgaatgactgcttt
caagcaaatgctcctgatcaattccctttctataaacccgaattaaggcaagcagccact
caagcatgggctgaatatacacctataagtatcccttttagtattaacaataaaaatttt
aactcattacaaatttaccgtacatttaagtttggaaatttgcttgagcttgtgttgaca
gatgagcgtctatatcgtgatgaacctccatcttgcgatgattctgtcacacaaaaacaa
cgttatgagactagaaaacgttatcttgtatcggatagtccccagaggaatgacgctcat
cgaaccatgcttggacacagacagcgtgactggttgatcaaacaaatttgtaattcttcc
tgtatttggaagatatggggcaacgaagtgatgacaatgcaattaaaacttctgtcagtc
tttgcaaccctatttttagggcagaaaactccagatttgttcattaatcttgatcagtgg
gatgcttatcctgcggagcggactttactatttaaagcgataaaagcagctaaagttaaa
aatttcgtcactattactggtgatcttcatacatttgttgcaggatatcaaaaactagat
tttgatgatcagagtgatcaacctatgggtgtagagtttgtagttggttcgatcacagcc
tctaatctggcagaaagaattaatttgaactcatttaatctacctttaccttcaattgaa
acagttactactttaattcaactcagtaatccacacatttgttatttcaattccaatacc
cacggctacaatatagtagaagtaacgccagaagcgttaatttgtactttcaaggtagtc
agtaatattatcaaaccaggagggagagtttctactctaaaagtttttcgtgttccccgc
gatcaagtattaattgaagatataacacctacttaa

DBGET integrated database retrieval system