KEGG   Nostoc sp. PCC 7524: Nos7524_4120Help
Entry
Nos7524_4120      CDS       T02363                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nos7524_4120
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_4120
   00052 Galactose metabolism
    Nos7524_4120
   00500 Starch and sucrose metabolism
    Nos7524_4120
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7524_4120
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nos7524_4120
   00524 Butirosin and neomycin biosynthesis
    Nos7524_4120
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nos7524_4120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4956696..4957721
Genome map
AA seq 341 aa AA seqDB search
MTLLLAGDIGGTKTILRLVEISDSSGLLTIYEESYLSGNFPDLVPMVQQFLLKANAGTPQ
KACFAIAGPVVNNTAKLTNLAWFLESDRLAQELGIPLISLINDFAAVGYGIFGLSKQDLL
TLQVGKHQQEAPIAVIGAGTGLGQGFLIKQGNHYQVFPSEGGHADFAPRNELEFQLLKYL
LDKHDIQRVSVERVVSGQGIVALYQFLRDRKLATESPEIAQIVRTWEQQAGQQEKSVDPG
AAIGKAGVEGSDRLSEQALQMFVDAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIQNG
NFMLNFTQKGRMRPLLAEIPVHIILNQQVGLIGAALCAARL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacattgttactagcaggagatatcggcggcacaaaaactattttgcgtttggtggaa
atatcagactcttctgggttgctgactatttatgaggaaagttatctgagtggcaatttt
cctgatttagtgccgatggtgcagcaatttttactgaaagctaacgcaggtacaccgcaa
aaggcttgttttgcgatcgccggtccagtggtcaataatacagccaaactcaccaactta
gcctggtttttagaaagcgatcgcctagcgcaagaattagggattcccctcatttccttg
attaatgattttgcggctgtgggctatggcatttttggcttgagtaaacaagacttgctg
actttgcaagtgggtaaacaccaacaggaagcacctattgccgttattggggctgggact
ggcttaggacaaggatttttgattaaacagggcaatcactatcaagtctttccctcggaa
gggggacacgccgattttgcccctcgcaatgagttagagtttcaactgttgaaatatctg
ctggataaacatgacattcagcgcgtgtctgtagaacgggtagtttctggacagggaatt
gtggctctttaccaatttctgcgcgatcgcaaactcgctaccgaatccccagaaattgct
caaattgtccgcacttgggaacagcaagccggacagcaggaaaaaagtgttgatcctggt
gctgcgattggtaaagctggagtggaaggaagcgatcgcctctcagaacaagctttgcaa
atgtttgtcgatgcttacggtgcagaagccggaaatctcgcccttaaacttttaccttac
ggcggcttatatatcgctggtggaattgcccctaaaatcttgcctttgattcaaaacggc
aatttcatgttaaatttcacccaaaaaggcagaatgcgccccttactagcagaaataccg
gtgcatatcattctcaatcaacaagttggcttaataggtgctgctttgtgtgctgctagg
ttataa

DBGET integrated database retrieval system