KEGG   Nostoc sp. PCC 7524: Nos7524_4200Help
Entry
Nos7524_4200      CDS       T02363                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7524_4200
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nos7524_4200
Enzymes [BR:nop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Nos7524_4200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5037621..5039000
Genome map
AA seq 459 aa AA seqDB search
MNPSSSLPDAKPAVAVDSSVLQIWGGHPLQGHVKISGAKNSALVIMAGALLCSGDCRIRN
VPLLADVERMAEVISALGVRLKRQGDILDINASEIATSKAPYELVTQLRASFFAIGPILA
RLGVAQMPLPGGCAIGARPVDLHVRGLQAMGAEVQIEHGICNAYVPGTGGRLKGAKIYLD
TPSVGATETLMMAATLADGETIIENAAREPEVVDLANFCNAMGAKIQGAGSSTITIVGVP
KLHSLDYSIIPDRIEAGTFLVAGAITRSELTLSPVLSDHLIPVIAKLRDIGVQIIEEGPD
CLRILPAETLKATDIETLPHPGFPTDMQAPFMALLTLAEGDSIINESVFENRLRHASELN
RLGADIRVKGNTAFVRGMPMLSGAPVIGTDLRASAALVLAGLAAEGKTTIQGLHHLDRGY
DQIDMKLQKLGARILRLGEVPADAEVAPTSSSPPASVST
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
attaatccttctagcagcttaccagatgctaaaccagctgttgcagtagactcctcagtc
ttgcaaatatggggcgggcatcctttgcagggtcatgtaaaaattagcggggcgaaaaat
tctgccttggtaatcatggctggagccttgctatgttcgggcgattgccgcatacgtaac
gttcccctattggcggatgtagaaaggatggctgaagtaatatcggcattaggtgtacgt
ctaaaacgacaaggcgatattttagatatcaatgccagcgagattgccacatcgaaagct
ccctatgaattagtgacgcaattgcgggcaagtttttttgccatagggccaattttggcc
agactgggagtagcacaaatgccattaccaggaggttgtgccattggagctagaccagtt
gatttgcacgtcagaggactgcaagcaatgggagctgaagtacagattgaacatggcatt
tgtaatgcttatgttcctggtactggtggcagattaaaaggagcgaaaatttacctagat
actcccagcgtcggagcaacagaaaccttgatgatggctgccacgttagcagatggcgaa
accatcattgaaaacgctgccagagaaccagaagtagttgatttagctaacttctgtaat
gcaatgggggcaaaaattcagggtgcgggtagcagcacaattaccattgtgggtgtaccc
aagctgcattctctcgattacagcattattcccgatcgcatcgaagcaggtacattttta
gtagccggagctatcactcgctctgagcttacactatcccctgttctatcggatcactta
attccagtgattgccaaactccgggatattggtgtacaaatcattgaggaaggaccagac
tgcttacggattctgcccgccgaaaccctgaaagcaacagatatagaaaccttgccccat
ccaggatttcccacagatatgcaagcaccattcatggccttacttaccctggcagaaggt
gacagcattattaacgaatccgtgtttgaaaatcgcttgcgtcatgcttccgaattaaat
cgtttaggggcagacattcgcgttaaaggtaatactgcctttgtgcggggaatgccgatg
ctgtctggtgcgccagtcattggtactgacttaagagcatcagcagcattagtcttagca
ggactagcagccgaaggcaaaaccactattcaagggttgcatcaccttgatcggggctac
gatcaaattgatatgaaattgcaaaaattaggcgctcgtatcctgcggttaggggaagta
ccagcagatgcagaagtagctcctactagcagcagtccaccagcatcagtttccacttaa

DBGET integrated database retrieval system