KEGG   Nostoc sp. PCC 7524: Nos7524_4282Help
Entry
Nos7524_4282      CDS       T02363                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:nop00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Nos7524_4282
Enzymes [BR:nop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Nos7524_4282
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Nos7524_4282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5125970..5126839)
Genome map
AA seq 289 aa AA seqDB search
MPELPEVETVRRGLNQLTLQRQITGGDVLLNRTIAHPFSVDDFVNAIAGKAIINWHRRGK
YLLAELSDTPPTPSTPPSPSGGWLGVHLRMTGQLLWLKPDEPLHKHTRVRIFFGDQQELR
FVDQRTFGQMWWVPPEVAVESVITGLGKLAVDPFSPEFTVEYLADKLHNRRRPIKTALLD
QSVVAGLGNIYADEALFKSGILPQTLCADLELKQIEPLRTAIIQVLETSIAAGGTTFSNF
LNVKGINGNYGGVAWVYNRAGEPCRVCGEVIQRVKLAGRSSHFCPQCQH
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcctgaagttgaaacagtccgccggggtttaaatcaattgaccctccaa
cggcaaatcacgggtggagatgtgttgctcaatcgcaccatcgcccaccctttttctgtg
gatgattttgtaaatgcgatcgcaggcaaagccataattaattggcatcgtcgcggtaag
tatctcttagcagaactctctgacactccccccactccctccactcccccatccccctcc
ggcggttggctgggtgtacatctgcgaatgaccggtcaattgttatggttaaagccagat
gaaccattgcacaagcacacacgagtcagaatcttctttggggatcaacaggaattgcgg
tttgttgatcagcgtactttcggacagatgtggtgggttccgccagaagtagctgtagaa
agtgtaattactggtttaggtaaactggcagttgatcccttctcgccagaattcactgtt
gagtatttagccgataagctgcataatcgccgtcgtccgattaagactgccttattagat
cagtcagtggtggctggcttgggtaatatctatgctgatgaagcactgtttaaaagtgga
atattacctcaaactctgtgtgcagatttagagttaaagcaaattgaacctttgcgaacc
gcgattattcaagtcttagaaaccagcattgcggctggcggtacaacttttagtaacttc
ctcaatgttaaggggatcaatggtaactatggcggtgtcgcctgggtttacaatcgtgct
ggagaaccctgtcgagtttgtggtgaggtaattcagagagtgaagttagcaggaagatcc
agtcatttttgtccccaatgtcagcattag

DBGET integrated database retrieval system