KEGG   Nostoc sp. PCC 7524: Nos7524_4460Help
Entry
Nos7524_4460      CDS       T02363                                 

Definition
di-heme enzyme, MXAN_0977 family
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nop  Nostoc sp. PCC 7524
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5332748..5333899)
Genome map
AA seq 383 aa AA seqDB search
MKLTRLFTLAVICLLSICLSMGLSKAFGKSPTSEYDWHLPAWMPKPIVPADNPMSSPKVE
LGRHLFYEKRLSITGEFSCASCHIQSLAFTDGKTVAVGATGEKHPRNSMSLANIGYNPVL
TWANPLITRLETQALVPMFGEHPVEMGMVGREQQILTMLRDDSKYRQMFAIAFGESQEAI
SLSNLTKALAAFERTLISVNSPYDRYRFGGDSDAISKAAQRGEKLFNSERLECFHCHGGI
NFSDSVMHDRLAFVEIAFHNTGLYNIDGKGAYPPDNTGVYEITTKPSDMGRFKAPTLRNI
ALTAPYMHDGSIPTLEAVIDHYKAGGRTIHTGKFAGVGSKNPFKSEFISGFELTEAEKND
LIAFLKSLTDETFIHNPAFSNPN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaactcgtttgtttaccctcgcagtaatttgtctgttgtcaatttgtctctca
atggggctaagtaaagcatttggcaaatcaccgacttcagaatatgactggcatctccca
gcttggatgccgaagccaattgtcccagccgataaccccatgagttcgccaaaagtagag
ttgggaaggcatcttttttatgagaagcggttatcaatcacgggtgaattctcttgtgcg
tcctgccatattcagtccttggctttcactgatgggaaaacggtggcggtgggagcaacc
ggcgaaaaacacccccgtaactccatgagtctcgctaatattggctacaacccagtatta
acttgggctaaccctttgataacaaggttggaaactcaagctttagtacccatgtttggg
gaacatccggtagaaatgggtatggtaggaagggaacaacaaatattaacaatgctgcgg
gatgactccaaatatcgacagatgtttgcaatagcctttggagaaagtcaggaagcgatt
agcttgagtaatctgactaaagctttagcagcttttgaacgtactttgatttccgtgaat
tctccctatgatcgttatcgcttcggtggcgactctgatgctatttcaaaagctgctcaa
cggggggaaaagttattcaacagcgaacgtctggaatgttttcattgtcatggtgggatt
aattttagcgattcggtgatgcacgatcgcctggcttttgtagaaatcgcttttcacaac
actggcctatataatattgacggcaaaggagcttatccaccagataatactggtgtttat
gaaattactaccaaaccctccgatatgggacgtttcaaagctccaactctgcgaaatatt
gctctcactgctccctatatgcacgatggtagtatccctactctagaagcagttatcgac
cactataaagcaggtgggagaacgattcatacaggaaagtttgccggagtaggcagcaaa
aatcctttcaagagtgaatttattagcggttttgaattaactgaagctgaaaaaaatgac
ctgatagctttcctaaaaagtttaactgatgaaacatttattcataaccctgcttttagc
aatcccaattaa

DBGET integrated database retrieval system