KEGG   Nostoc sp. PCC 7524: Nos7524_4536Help
Entry
Nos7524_4536      CDS       T02363                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nos7524_4536
   00330 Arginine and proline metabolism
    Nos7524_4536
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Nos7524_4536
Enzymes [BR:nop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Nos7524_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5427867..5428781
Genome map
AA seq 304 aa AA seqDB search
MTGIDRLNAVEFSNWVQLGKTQIHLGRVADRIPQLAIVDPRLFAVHICCKSGKTYSEGDI
SSLFPLMSVIKPFSLLYLLEHLGAEKVLAWVGVEASDAPFNSLEQLVADGGQPRNPMINS
GAIALADKLPGTDANHRTQSFCQWLNQLAGCHLKLDEVMLAAVRQSRSPANQAIANYLAD
KQQIENLDIALDTYEQICCLSGQVADLALLGKLLAWEHDEIKLPHRQIVNAIMLTCGLYQ
ASSLFAVKIGLPMKSGIGGGLLAIVPGQGAIACYSPALDSIGNPVGAIAFVEVLSQKLGL
SIFS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggaattgacagactaaacgcggtggagttttcaaattgggtacaactagggaaa
actcagatacatctgggacgagttgccgatcgcattccgcaattagctatagttgatccc
cgtttgtttgcagttcatatctgctgtaaatcgggaaaaacttacagtgagggagatata
tcttctctcttcccattgatgagtgtgattaagccattttctctactgtatctattagaa
catctaggagcagaaaaggttcttgcttgggttggggtggaagcatcggatgcaccattt
aattctttggaacaactggtggctgatggcggacaaccacgtaatcccatgattaatagt
ggtgcgatcgctttagctgataagttaccaggaaccgatgctaatcatcgcactcagtct
ttttgtcaatggttaaatcaattggctggttgtcatctcaagttagatgaggtgatgctg
gctgcggtgagacaatcaagatcgcctgctaatcaagcgatcgctaattatctcgctgac
aaacaacagatagaaaatcttgatatagctcttgacacttacgagcaaatatgctgtcta
tctgggcaagtggcagatttagccttgctgggaaaacttttagcctgggagcatgatgaa
atcaaattaccacaccgtcagattgtcaatgctatcatgttaacctgcggtttatatcaa
gcttctagtttgttcgccgtcaaaattggactaccgatgaaatctgggattggtgggggt
ttattagcaatagttcccggacagggagcgatcgcttgctacagtccagccttagatagt
atagggaatccagtaggagcgatcgcttttgttgaggtgttatcccaaaagttgggattg
agtatttttagttag

DBGET integrated database retrieval system