KEGG   Nostoc sp. PCC 7524: Nos7524_4606Help
Entry
Nos7524_4606      CDS       T02363                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nos7524_4606
Enzymes [BR:nop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Nos7524_4606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5506098..5507606)
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGVLLHPTSFPSRFGIGDLGLEAYKFIDFLRESYQQYWQVLPLGPTGYGNSPYA
CYSALAGNPMLISPEQLQEQGFLSEDDFANLPEFDAFQVDYDRVIPIKTELLKKACANFQ
VKATALQQKEFSGFCQSKAYWLDDYALFMALKDAHDGTSWHTWEQELVKRDPAVIEQSRL
KLNAEIYYYKFIQFEFFRQWSELKTYANMSGVYIIGDIPIYVAQDSADVWAHPDIFCLDE
ETMEPALMAGVPPDYFSATGQLWGNPVYNWEELQKQDFSWWLGRFEAMLDYVDVIRIDHF
RGFEAYWAVPQGEETAIKGEWLKAPGEELFDAIKQKLGKLPVLAEDLGIITPEVEALRDK
YEFPGMKVLQFAFGSDPGNPFLPFNYSRNFVVYTGTHDNDTTVGWFNQANDYEKQNLLLY
LGCVSPEGIHWDLIRLALSSIANQAIIPLQDILGLGTEARMNFPSTAEGNWDWRYEPKAL
TEQLSDRLKILTKLYGRAPQGK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagatccagtggcgttttgctgcatcctacctcctttcccagtcgattt
ggtattggcgatttaggcttagaagcctacaagtttattgattttctcagagaaagctac
caacaatattggcaagtcctacctttagggccaactggttacggtaattctccttatgct
tgctattcggcattggcaggaaatcccatgctgattagtccagaacaattacaagagcag
ggtttcttatctgaagacgactttgctaatttaccagaatttgacgcttttcaagtagat
tatgaccgagttatacctatcaagactgaactattaaaaaaagcctgtgccaattttcaa
gttaaagctacagctttacaacaaaaagagttttctggtttttgtcagagcaaagcttat
tggttagatgattatgctttatttatggcgctgaaagatgcccatgatggtacaagttgg
catacttgggaacaggaattagtcaaacgtgatcccgcagtaattgagcaatctagacta
aaactaaatgctgagatttactattataaatttatccagtttgaattctttcgccagtgg
tcggaactgaaaacttatgccaacatgagcggggtttacattattggcgatattcctatt
tatgtagctcaagatagtgctgatgtgtgggcgcatcccgatatcttttgtttagatgag
gagacaatggaaccggcattaatggctggcgttccaccggattattttagtgctactggt
caattatggggcaacccggtttataactgggaagaattacaaaaacaagatttttcttgg
tggttgggtcgctttgaagcgatgctggattatgtggatgtcatccgcattgatcacttc
cgggggtttgaagcttattgggctgtaccacaaggtgaagaaacagcgattaagggagaa
tggttaaaagccccaggagaagaattatttgatgcgattaaacaaaaattgggtaagctg
cctgtattagccgaggatttaggcatcattacgccagaggtggaagcactgcgagataag
tatgaatttccggggatgaaggttttacagtttgcctttggttctgatcccggcaatcca
tttttaccattcaattactcgcggaatttcgttgtttacactggcacccacgataatgac
acaactgtcggctggtttaatcaagccaatgactacgaaaaacaaaacttgttactttat
ttagggtgtgtcagccctgaagggattcattgggatttaattagactggctttgagttct
attgctaatcaagcgattattcctttgcaggatattttgggtttgggaactgaagcgcga
atgaattttcctagcactgctgaaggtaactgggattggcgttatgagccgaaagcgtta
acagaacagttaagcgatcgcctcaaaattcttactaagctctacggacgcgctccacaa
ggaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system