KEGG   Nostoc sp. PCC 7524: Nos7524_4712Help
Entry
Nos7524_4712      CDS       T02363                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nop  Nostoc sp. PCC 7524
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7524_4712
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Nos7524_4712
Enzymes [BR:nop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nos7524_4712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5637222..5638307)
Genome map
AA seq 361 aa AA seqDB search
MPVLRNLARFGHHLILGISGTQLSDDDKRALNELKPIGVIFFAKNFQDGVPYEVWLQSFQ
HLSQQIREYAERPSMFFTLDHEGGRVVRTPLPITRFPHALLLRSHAREVAKATGIELKSL
GINLSWSPVADIYSNPQNPIIGPRAFGSTPETATQAIIEYYLGLKESGVLGCAKHFPGHG
DTNKDSHVELPILNLSLEDLRIRELIPFKALIAEHIPIIMTAHILFPQIDPDLPATLSRA
ILKNILREELGFEGIVVSDDLDMKAVSDMFIQSGTVARAFYAGCDLFIVSRNIHSSSIER
TYQIAEDFLESLNKGTLAESVVEAAKERIDQLLAVTPQYAVQMLDKNTLVQHAELAIASA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcttacggaatctagcacgcttcggacatcatctgattcttggcatttccggt
actcagttaagtgatgatgataaacgcgcacttaatgaactcaaaccaattggagtcatc
ttttttgccaaaaattttcaggatggtgtcccctatgaagtatggctgcaaagttttcag
catttgagccagcaaatcagagaatatgctgaacgcccttccatgttttttaccttagat
catgaaggggggcgtgtggtgcggacacctctaccaattaccagatttcctcatgctttg
ctgttgcgatcgcacgcacgggaagtagcaaaagctacgggtattgaattaaagtccttg
ggcattaacttgtcttggtcgccggtagcggatatttattctaatccccaaaatcccatc
attgggcctcgcgcctttggtagcacgccggaaacggctactcaagctatcatcgaatat
tacctgggactcaaggaatcaggagttttggggtgcgccaagcattttcctggacatgga
gatactaataaggactctcatgttgagttaccaattcttaatctcagtttagaagactta
cgcattcgagaactcatacccttcaaagccttgattgcggaacatattcccatcatcatg
acggctcatattttgtttccgcaaatcgaccctgatttacctgcaaccctatcaagagct
atcctcaaaaacattctgcgggaagaattgggatttgagggcatagtagtatctgatgac
ttggatatgaaagctgtctcagatatgtttattcaaagcggtacagtggcgcgggcgttt
tatgctggctgtgatttatttattgtctcgcgtaacatccattcatcatctattgagcgt
acttatcaaattgctgaagatttcctggaatctttaaataaaggtacgttggctgaatct
gtggtagaagcagctaaagagagaattgatcagttattagcagtcactccccaatatgct
gtacaaatgttagataaaaatacattagtgcagcacgcagaattagcgatcgcttctgct
ttttag

DBGET integrated database retrieval system