KEGG   Nostoc sp. PCC 7524: Nos7524_5597Help
Entry
Nos7524_5597      CDS       T02363                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nop  Nostoc sp. PCC 7524
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Nos7524_5597
Enzymes [BR:nop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Nos7524_5597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNOS7524.01:5045..6619
Genome map
AA seq 524 aa AA seqDB search
MSQMLNRRRFLQASAAAAASIGVSTIRTSAGGVDEYVEAIVIGSGFGGAVASLRLGQAGI
ETIVLERGRRWQITDSGDTFSTTDNPDGRAAWLSPTTVLPPPVPEIPIDVYTGVLDVKRG
NGINVYRGAGVGGGSLVYGAITYQPTEELFYKVFPRTINYTRLDRIYYPRVRSILKASPI
PDDILQTEYYLASRILMEQARKAGLNTRKIDAAIDWDIVRQEIAGKKVASIINGQVYYGT
NSGAKNSLDRNYLSMAEATGNIEIRPLHVVTMIGESDRGRYRVVCNQINEQGEVLVQKSF
VCRYLFLAAGSIGTTELLLRAKTNRTLRRLNNQVGKFWGTNSDSTTLMINAGETNPTPGN
PGVIAVEHLDNPIAPVILEAFHGLPFVPQGILPVLGQGISKPEGYLTYNTATKLADLFWP
NNSADSQRNAQALLYTYQRLNQANGTSLAAPPDYSFTAHPLGGATIGQVCNTHGQVFGYP
NLFVVDGALIPGSTACSNPSLTIAALAERSMDQFLNRIPRRRKI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaatgctaaatcgtcgtcgatttcttcaggcatcggcggcggcggcggccagc
ataggtgtatccactattcgcacctctgctggtggtgttgacgagtatgttgaggcgata
gtcattggtagtggttttggcggtgcagttgcatcattgcgtcttggtcaggctggaatt
gaaacaatcgtattggaacggggacgacgatggcaaattactgattcaggtgatactttc
tctacaacagataacccagatggtcgtgctgcatggctcagtcccactacggttttacct
ccaccagttccagaaatccccattgatgtatatactggcgttcttgatgtcaaaagaggt
aatggtatcaatgtataccgtggtgcaggtgttgggggtggttcgcttgtctacggtgct
atcacttatcaaccgacggaagaactattctataaagtttttccacgcactattaactac
accagactggatcggatttattacccacgggtgcgttccatcctcaaagcatcccccatc
ccagacgatattcttcaaactgaatactacttagcaagccgcatcctcatggagcaagcc
cgtaaggctggtttgaatacacgcaagattgacgcagccattgattgggatattgttcgt
caggaaatagcaggtaaaaaggttgcttccattattaatggtcaagtttattacggtaca
aatagtggggcgaaaaacagcttagatcgcaactacctcagtatggcagaggcgactggt
aacattgaaattcgaccgttacacgtagtcactatgattggagaatcagatcgtgggcgt
taccgggttgtttgcaatcaaattaatgagcaaggagaagtgcttgtccaaaaatccttt
gtttgtcgctatctatttttggcggcaggttcgattggcactactgaactattgctgcgt
gctaaaaccaatcgtactttgcgccgactaaataatcaggtaggaaagttttggggaaca
aattccgattcaactactttaatgattaatgctggcgaaacgaatccaacaccagggaat
ccgggtgtaatcgcagttgagcatctcgacaaccctattgccccagtgatacttgaagca
tttcacggacttccttttgtaccacaaggtattcttcctgttcttggtcagggaatttcc
aaaccggagggctatcttacctacaatacagctactaagttagcagatttgttctggcct
aacaactcagccgatagtcaaagaaatgctcaggctctcttgtatacttatcaacggctc
aaccaagccaatggtacaagtcttgctgcaccgcctgactacagttttacagcacaccca
cttggcggtgcaacaattgggcaagtatgcaatactcatgggcaggtgtttggttatcct
aatttgtttgtggttgatggtgcgctgattcctggttcaacagcctgctcaaatccctcg
ctgactattgctgctttggcagaacggagtatggatcaatttctcaaccggattcctaga
cgtagaaaaatataa

DBGET integrated database retrieval system