KEGG   Nostoc sp. PCC 7524: Nos7524_5597Help
Entry
Nos7524_5597      CDS       T02363                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nop  Nostoc sp. PCC 7524
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNOS7524.01:5045..6619
Genome map
AA seq 524 aa AA seqDB search
MSQMLNRRRFLQASAAAAASIGVSTIRTSAGGVDEYVEAIVIGSGFGGAVASLRLGQAGI
ETIVLERGRRWQITDSGDTFSTTDNPDGRAAWLSPTTVLPPPVPEIPIDVYTGVLDVKRG
NGINVYRGAGVGGGSLVYGAITYQPTEELFYKVFPRTINYTRLDRIYYPRVRSILKASPI
PDDILQTEYYLASRILMEQARKAGLNTRKIDAAIDWDIVRQEIAGKKVASIINGQVYYGT
NSGAKNSLDRNYLSMAEATGNIEIRPLHVVTMIGESDRGRYRVVCNQINEQGEVLVQKSF
VCRYLFLAAGSIGTTELLLRAKTNRTLRRLNNQVGKFWGTNSDSTTLMINAGETNPTPGN
PGVIAVEHLDNPIAPVILEAFHGLPFVPQGILPVLGQGISKPEGYLTYNTATKLADLFWP
NNSADSQRNAQALLYTYQRLNQANGTSLAAPPDYSFTAHPLGGATIGQVCNTHGQVFGYP
NLFVVDGALIPGSTACSNPSLTIAALAERSMDQFLNRIPRRRKI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaatgctaaatcgtcgtcgatttcttcaggcatcggcggcggcggcggccagc
ataggtgtatccactattcgcacctctgctggtggtgttgacgagtatgttgaggcgata
gtcattggtagtggttttggcggtgcagttgcatcattgcgtcttggtcaggctggaatt
gaaacaatcgtattggaacggggacgacgatggcaaattactgattcaggtgatactttc
tctacaacagataacccagatggtcgtgctgcatggctcagtcccactacggttttacct
ccaccagttccagaaatccccattgatgtatatactggcgttcttgatgtcaaaagaggt
aatggtatcaatgtataccgtggtgcaggtgttgggggtggttcgcttgtctacggtgct
atcacttatcaaccgacggaagaactattctataaagtttttccacgcactattaactac
accagactggatcggatttattacccacgggtgcgttccatcctcaaagcatcccccatc
ccagacgatattcttcaaactgaatactacttagcaagccgcatcctcatggagcaagcc
cgtaaggctggtttgaatacacgcaagattgacgcagccattgattgggatattgttcgt
caggaaatagcaggtaaaaaggttgcttccattattaatggtcaagtttattacggtaca
aatagtggggcgaaaaacagcttagatcgcaactacctcagtatggcagaggcgactggt
aacattgaaattcgaccgttacacgtagtcactatgattggagaatcagatcgtgggcgt
taccgggttgtttgcaatcaaattaatgagcaaggagaagtgcttgtccaaaaatccttt
gtttgtcgctatctatttttggcggcaggttcgattggcactactgaactattgctgcgt
gctaaaaccaatcgtactttgcgccgactaaataatcaggtaggaaagttttggggaaca
aattccgattcaactactttaatgattaatgctggcgaaacgaatccaacaccagggaat
ccgggtgtaatcgcagttgagcatctcgacaaccctattgccccagtgatacttgaagca
tttcacggacttccttttgtaccacaaggtattcttcctgttcttggtcagggaatttcc
aaaccggagggctatcttacctacaatacagctactaagttagcagatttgttctggcct
aacaactcagccgatagtcaaagaaatgctcaggctctcttgtatacttatcaacggctc
aaccaagccaatggtacaagtcttgctgcaccgcctgactacagttttacagcacaccca
cttggcggtgcaacaattgggcaagtatgcaatactcatgggcaggtgtttggttatcct
aatttgtttgtggttgatggtgcgctgattcctggttcaacagcctgctcaaatccctcg
ctgactattgctgctttggcagaacggagtatggatcaatttctcaaccggattcctaga
cgtagaaaaatataa

DBGET integrated database retrieval system