KEGG   Nostoc sp. PCC 7107: Nos7107_0117Help
Entry
Nos7107_0117      CDS       T02362                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7107_0117
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nos7107_0117
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nos7107_0117
Enzymes [BR:nos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nos7107_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142335..143639
Genome map
AA seq 434 aa AA seqDB search
MTQATSTHTQTTTATLEALKCKECGAEYELKASHVCEFCFGPLEVKYNYNNIRLSVSREK
IQAGPNSIWRYREFLPVATDNVIDVGTGMTPLVRSQRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKVLGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFTKIYKGFKEFVEVGLVEGKNVRFSGAQAEGCSPIAQAFREDRDFIK
PVKPNTIAKSIAIGNPADGVYAVEIAKKTGGNIESVTDAEIIEGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPNETTVVYITGNGLKTQEAIQGYVGEPLTIDAKLDSFERALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcaacctccacacacacccaaacaaccacagccaccttagaagctttgaag
tgtaaggaatgtggcgcggaatacgaacttaaagccagtcatgtttgtgagttttgcttt
gggccgttggaagtgaaatataactacaacaatatccgcctgagtgttagccgcgaaaaa
atccaagccgggccaaattcaatctggcgctatcgggaatttttacctgttgcaactgac
aatgtaattgatgtgggaactgggatgactcctttggtgcgttcccaacgtttggcgcgt
cgcctgggtctgaataagctttacattaaaaatgatgccgtcaacatgcccaccctcagc
ttcaaggatcgggtggtatcggtggcgctgtctcgcgcacgagagttaggttttacgaca
gtatcttgtgctagtactggtaacttagcaaattctacagctgcgatcgcagcccatgca
ggtttagactgttgcgtgttcatcccctctgatttagaagcaggcaaagttttaggtagc
ttgatttacagcccaactcttatggctgttaaaggcaattatgatcaagtaaaccgcctg
tgttcagaagttgcaaatacacatggttggggttttgtgaacattaatctgcgcccttac
tactctgaaggttccaaaactcttggctttgaagttgcagaacaacttggttgggaactc
ccagatcatatagttgcgcctttggcttctggttcgctgtttaccaaaatctataaaggc
ttcaaagaatttgtcgaagttggtttggtagaaggtaaaaatgttcgtttcagcggcgca
caagctgaaggttgttcacccatcgcccaagcatttagagaagaccgcgacttcattaaa
cctgtgaaaccaaatacaattgctaaatcgatcgcaattggcaatccagcggatggtgta
tatgctgtcgaaattgcgaagaagacaggcggtaatatagaatcagtcaccgatgcagaa
attattgaaggcatcaagctgctggcagaaactgaaggtatctttacagaaacagctggc
ggtacaactgtagctgtgctgaaaaaattggtagaagctggcaaaattgatccaaatgaa
actaccgtagtttacatcactggtaatggtttgaaaacccaagaagcaattcaaggttac
gttggcgaaccgttgacaattgatgctaaactcgatagctttgaacgtgcgctagaacgc
tctcgcactcttgaccgcttagaatggcaacaagttctagtttaa

DBGET integrated database retrieval system