KEGG   Nostoc sp. PCC 7107: Nos7107_0172Help
Entry
Nos7107_0172      CDS       T02362                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7107_0172
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nos7107_0172
Enzymes [BR:nos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nos7107_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214738..215634
Genome map
AA seq 298 aa AA seqDB search
MQIRRRSPSPAIDVSILRYQVAVPNAKPNNILEEIVWQKEVEVDQLREKQPLVELQKQAL
SAPPTRDFIAALKQGKTKPALIAEVKKASPSKGILREDFDPIAIAKSYQQGGASCISVLT
DVKFFQGSFDNLAKVRAAVDLPLLCKDFIIYPYQMYLARIQGADAVLLIAAILSDQDLQY
FIKIAKALNMAALIEVHSLEELDRVLALDGVSLVGINNRNLEDFTVDLQTTCQLLAARGE
QLQARNILVVSESGLHTPEDLSLVEQAGASAVLIGESLVKQPDPELAIAQILPKSNSI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgtcgccgttcacctagccccgctatagatgtatccatcttgcgttatcag
gttgctgtaccaaatgccaaaccaaacaatattttagaagaaattgtctggcaaaaagaa
gttgaagttgaccaactgcgggaaaagcagcctttggttgaattacaaaagcaagcactt
tccgcaccgccaacacgagattttatcgccgccctcaaacaaggtaaaaccaaaccagcg
ttaattgccgaagtcaaaaaagcttcaccaagtaaaggcattttacgcgaagattttgac
cctatagcgatcgccaaatcatatcaacaaggtggtgctagttgtatttctgttttgaca
gatgtgaaattttttcaaggcagctttgacaacttagctaaagtacgcgctgctgtcgat
ttacccttattgtgtaaagattttattatctatccttaccaaatgtatttagcccgcatt
cagggtgcggatgccgttttattaatcgcggctattttgagtgaccaagacttgcagtac
ttcatcaaaattgctaaagccttaaatatggcagcattgattgaagttcatagtctagaa
gaactcgatcgggtattagctttagatggtgtttctttagttggcattaacaatcgcaat
cttgaagatttcaccgtagatttgcagacgacttgtcaacttttagccgccaggggtgaa
caattacaagcacgaaatattttagttgttagtgaatcaggtttacatacacctgaagat
ttgagtttagtagaacaagcaggtgcaagtgctgtgttaattggcgaatcattagtcaaa
caaccagacccagaattagcgatcgcccagatcttacccaagagtaattccatctaa

DBGET integrated database retrieval system