KEGG   Nostoc sp. PCC 7107: Nos7107_0337Help
Entry
Nos7107_0337      CDS       T02362                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nos7107_0337
Enzymes [BR:nos01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Nos7107_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
390541..391578
Genome map
AA seq 345 aa AA seqDB search
MINQLSDYNPSGVGEINGNLFGLPFDYESANLIVFAVPWEVTVSYGAGTANGPQRILDAS
TQLDLFDFDNPDGWKQGIYLVEIPQDILEKNHYYRTLAAQIIERLAQGKPLTETPDLTPI
LTEINQASQQVNQWLFTQSQAAINQGKQVAVIGGDHSSPLGYFQALATKYPNYGILHIDA
HADLRDAYEGFEFSHASIMFNAVKLPQISKLVQVGLRDISHDEVQMIDQSDSRIVAYYDP
AIKQKLYAGTTWIDICREIINHLPENVYISFDIDGLDPKLCPNTGTPVAGGLELEQTFCI
LRELVNSGRKIIGFDVCEVGDAEWDGNVGARVMYKLANFMELSQR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccaactctcagactataatcctagtggtgtaggtgaaattaatggcaacctc
tttggtttaccatttgattacgagtccgccaacttaattgtttttgccgtaccttgggaa
gttactgtttcttatggtgcaggtacagcaaacggcccccaaagaatccttgacgcttca
actcaactggatttatttgattttgacaaccctgatggctggaaacagggaatttattta
gttgaaattccccaagatattttagaaaaaaatcactactatcgcactttagctgcccaa
attattgaaagattagcacaaggcaaacccctaacagaaacacccgatttaactccaatt
ctgacagaaattaatcaggcttcccaacaagtgaatcaatggctatttacccaatctcaa
gcagcaatcaatcaaggtaaacaagttgcagtcattggtggagatcacagttcaccatta
gggtattttcaggcattagcaactaaatatcccaattacggcattctgcatattgatgca
catgcagatttacgtgatgcttatgagggatttgaattttctcacgcctcaatcatgttt
aatgctgtgaaactaccgcaaatttctaagttagttcaggtaggtttacgtgatattagt
catgatgaagtgcaaatgattgaccaatcagatagtcgcattgttgcctattatgaccca
gccatcaagcaaaaactgtatgctggcacaacctggattgatatatgtcgtgaaattatc
aatcatttgccagaaaatgtttatattagcttcgatatcgatggtttagatccgaagctt
tgtcccaatacaggtactcctgtcgctggtggtttggaattagagcaaacattctgtata
ttacgtgaattagtcaatagcgggagaaaaattattggctttgatgtttgtgaagttggt
gatgcagagtgggatggcaatgtcggtgctagagtcatgtataagctggcgaattttatg
gaattatctcagcgatga

DBGET integrated database retrieval system