KEGG   Nostoc sp. PCC 7107: Nos7107_0394Help
Entry
Nos7107_0394      CDS       T02362                                 

Definition
Polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nos7107_0394
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7107_0394
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7107_0394
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Nos7107_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454376..455083
Genome map
AA seq 235 aa AA seqDB search
MVDENGSIRTLSVDIGGSGVKAMVLDITGTPLTERARVDTPSPARPEVVINAIAVLAAAQ
GDFHRVSVGFPGVVRCGVTETAVNLHSDWVGFDLATVLSQRLNKPVRVINDADMQGLGAI
AGKGVELVVTLGTGFGSALFVDGKLVPNMEMGHHQFRKKQTYEEQLGRAALQKYGEKKWN
RRLEKAIISLQHLFNYDYLYIGGGEAVKINLQLPLNVKLVPNVTGLLGGIALWRD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgaaaatggttcaattcgcactttatcagttgatattggtggtagcggtgtt
aaagcgatggttttggatattactggaactcccctcacagaaagggcgagggtagataca
ccatccccagcaagaccggaagtggtaattaatgcgatcgcagttttagccgccgcccaa
ggtgattttcatcgcgtttcggtgggttttcctggtgtggtgcgctgtggagtcacagaa
acagcggtaaatttacattctgattgggttggctttgacttagccacagtattgtctcaa
cgtttaaataagccagtacgggtaattaatgatgcagatatgcaaggcttaggtgcgatc
gctggtaaaggtgtagagttagtcgttaccttggggactggctttggttcagctttattt
gttgatggtaaacttgtgccaaatatggaaatgggacaccatcagttccgcaaaaaacag
acttacgaagaacaattaggacgtgcagctttacaaaagtatggcgagaaaaaatggaac
agacgcttagaaaaagcgatcatctctttacagcatttatttaattatgattatctttat
atcggtggtggtgaagctgtgaaaattaatttacaactaccacttaatgtcaaacttgtt
cctaatgtgacaggtttgttaggtggaattgctttgtggcgcgattag

DBGET integrated database retrieval system