KEGG   Nostoc sp. PCC 7107: Nos7107_0535Help
Entry
Nos7107_0535      CDS       T02362                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nos7107_0535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7107_0535
   00052 Galactose metabolism
    Nos7107_0535
   00500 Starch and sucrose metabolism
    Nos7107_0535
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7107_0535
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nos7107_0535
   00524 Butirosin and neomycin biosynthesis
    Nos7107_0535
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nos7107_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626841..627866
Genome map
AA seq 341 aa AA seqDB search
MTLLLAGDIGGTKTILRLVETSETQDLQTIYEDSYRSGDFPDLVPMVQQFLLKANTGIPQ
KACFAIAGPVVNNTAKLTNLAWYLDTERLQQELSIAAISLINDFAAVGYGIFGLSAEDLL
TLQPGKQKLAAPIAVIGAGTGLGQGFLMKQGDNYQVFPSEGGHADFAPRNELEFQLMKYL
LDKHDIQRVSVERVVSGLGIVAIYQFLRDRKHATESPEIAQAVRTWEQEAGQPEKSVDPG
AVIGKAAVQKSDRLSEQTLQLFVDAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIQNG
NFLLNFTQKGRMRSLLADVPVYIILNPQVGLIGAALCAARL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactttgttactagcaggagatatcggtggcacaaaaaccattttgcgattagtggaa
acatcagaaacacaagatttacagactatttatgaggacagttatcgtagtggggatttt
cctgatttagtgccgatggtacagcagtttttacttaaagcaaatacaggaattcctcaa
aaagcttgttttgcgatcgctgggccagtagtcaataacacagcaaaattaactaacctt
gcatggtatttagataccgaacgtctgcaacaagaattaagtattgcggcaatttcgctg
attaatgactttgcggctgtgggctatggaattttcggtttaagtgcagaagatttactg
actttacaaccagggaaacagaaactagcagcacctatcgcggtgattggtgcaggtact
ggattaggacaaggctttttgatgaagcagggagataattatcaagtttttccttctgaa
ggtggtcacgccgactttgcccctcgcaatgagttagaatttcagctgatgaaatatttg
ctggataaacatgatatccagcgtgtttctgtagaacgcgttgtatccgggttgggtatt
gtggcgatttaccaatttctgcgcgaccgcaaacatgcgacggaatccccagaaatcgcc
caagctgtgagaacttgggaacaagaagccggacagccagaaaaaagtgttgatcctggt
gcggtgattggtaaagccgcagtgcagaaaagcgatcgcctctcggaacaaactctacag
ttatttgttgatgcttacggtgcagaagctggaaatctcgccttgaaacttttgccttac
ggtggtttgtacatcgctggtggaattgccccaaaaattctacctttaattcaaaacggt
aatttcttattgaacttcacgcaaaaaggccgaatgcgttctcttttggcagatgtacca
gtatatattattctcaacccccaagtaggattaataggtgcagctttgtgtgcagctagg
ttataa

DBGET integrated database retrieval system