KEGG   Nostoc sp. PCC 7107: Nos7107_0626Help
Entry
Nos7107_0626      CDS       T02362                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nos01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nos00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nos00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nos00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nos00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nos00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(740807..741769)
Genome map
AA seq 320 aa AA seqDB search
MTLILALDFGGTKLAAAITQLGSREWLRHERRLSPIDGNATTDLAIMRSLIHSLLQNTTP
DVIGVSFGGPVDFTTGTVRLSHHVPGWENLPLKDLLEKEFAISAIVDNDANIAALGEHRF
GAGEGYDSLFYITISTGVGGGWILNGQPWRGNAGMAGEIGHIVVNPAGPMCLCGKQGCVE
RLASGPYMAQDAKEYLLKQANQLQGKQLRSLVNDNLNLITGQIISAAATQGDELAIKILQ
SGAWALGVGIGNVANLINPQRFILGGSVTKAGEIWWNTVQKTARETALPEIDFEIVAAAL
GDDAPLWGAVALAESGLISK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacactgattctagccttagattttggtggtactaagttagccgcagccatcactcaa
cttggttcccgcgaatggttgcgtcatgaacgtcgtctctcaccaatagatggtaatgct
accactgatttagcaattatgcgatcgctcattcatagtttgctgcaaaatacaactccc
gatgtaattggggttagttttggtggccctgtggactttactaccggaactgtccgactt
tctcatcacgttcctggctgggaaaatctacctctcaaagacttgctagaaaaagaattt
gctatatctgccattgtagataacgatgctaatattgcggctttaggcgaacatcgtttt
ggcgctggtgaaggatacgatagcttgttttacatcaccatcagcactggtgttggcggt
ggttggatactcaatggtcaaccttggcgcggtaacgcaggtatggctggtgaaattgga
cacatagttgtcaatcctgcggggccaatgtgtttatgtggtaagcaaggatgtgtagaa
cggttagcatcaggcccttacatggcgcaagatgctaaagagtatttattaaaacaagca
aatcaattacaaggtaaacaattacgcagcttagtgaatgacaatttaaatttaattact
gggcaaattatcagcgcagcagctactcaaggtgatgagttagcaatcaagattttgcaa
agtggtgcttgggctttaggtgtgggtattggtaatgtagcgaatttaattaacccacaa
cgatttattttaggtggtagtgtaactaaagctggagaaatttggtggaatactgtacaa
aaaacagcccgtgaaacagcgttaccagaaatagattttgaaattgttgctgctgcgttg
ggagatgatgcaccactgtggggcgctgtagctttggcggaatcaggattaatctctaaa
taa

DBGET integrated database retrieval system