KEGG   Nostoc sp. PCC 7107: Nos7107_0687Help
Entry
Nos7107_0687      CDS       T02362                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7107_0687
Enzymes [BR:nos01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Nos7107_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802199..803323
Genome map
AA seq 374 aa AA seqDB search
MTPTAQSTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKTTTIRAL
ADLLPEIPVVANDPFNSHPSDPDLMSDEVRQQLQQGADIPVDHRKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNP
PVFLEQHKTEQESLQQKVVNAQTLLPEVKIDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALAAYEGRTEVTLDDIRRVITLCLRHRLRKDPLESIDSGYKVEKVFARVFGVELPEEDL
AKKNGTGQIKTGVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgactccaactgctcaatccacggcaagtgcgcgtcgcgtggtatttccatttacggca
attgtaggccaggaagaaatgaaactggcgctgcttttgaacgtgattgaccccaaaatc
ggtggtgtcatgattatgggcgatcgcggcaccggcaagacaacaactatccgggcgtta
gcggatttgttgccagaaatccctgtagttgctaatgaccccttcaatagtcaccccagc
gaccctgatctgatgagcgatgaagtccgccaacaactacaacaaggtgcggatattccc
gtagaccacaggaaagttcagatggtagacctgccattgggagctacagaagaccgggta
tgtggcactatcgacattgagaaagctttgtctgagggtgtgaaagcctttgaaccagga
ctactggctaaagctaaccgaggcattctttacgtggatgaagtcaacttgcttgatgat
caccttgtagatgtgttactcgattccgctgctagtggctggaacactgtagaacgggaa
ggaatttctatccgccacccagcgcggtttgtccttgttggttcggggaacccggaagaa
ggcgaattgcgtccccagttactcgaccgttttggaatgcacgccgaaattcacacggtg
aaagaaccagccttgcgggtgcaaattgtcgaacaacgctcggaatttgaccaaaatccg
ccagtatttctggaacagcacaaaacagagcaagaatcactccagcagaaagttgtcaat
gcccaaactctgttaccagaagtcaaaattgactatgatctgcgggtgaaaatttcggaa
gtttgttctgagttagatgtggatggtttgcggggtgatattgtgaccaaccgcgccgct
aaagcattagccgcctatgaaggacgtaccgaagtcacccttgatgatatccgacgggta
attactttgtgcttgcgtcacaggttgcggaaagaccctcttgagtccattgattctggc
tataaagtggaaaaagtttttgctcgtgtttttggtgtagagttgccagaagaagattta
gcaaagaaaaacggcacaggacaaattaaaacgggtgtgcgctaa

DBGET integrated database retrieval system