KEGG   Nostoc sp. PCC 7107: Nos7107_0802Help
Entry
Nos7107_0802      CDS       T02362                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nos00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
952791..954662
Genome map
AA seq 623 aa AA seqDB search
MCGITGILNLDGDPVSPVILKKMTDAIAHRGPDGEGQYIDNGLGLGHRRLAIIDLSPAGH
QPMSTIDGQLIMTYNGEIYNFNELRIELESLGYQFRSRTDSEVLLYAYAEWREKCLERFN
GMFAFAIWDKRRRELFLARDRYGIKPLYYTNTGTKFIFGSEVKAIIAHPDYPRSIDFEGL
LEYLTFQNFLTEKTLFKDIKLLPAGTYMCLSLDTQKSVQQQYWDYHFVEPDNPLDDREYL
EELDRLFRQAINRQLISDVELGAYLSGGIDSGSITAIAAQQLPYIKSFTCGFDLNSASGV
EVSYDEREAAEYMSYLFKTEHYEMVLKAGDMERVMPRLAWHLEEPRVGQSYPNFYVAQLA
SKFVKVVLAGTGGDELFAGYPWRYYRAVVNDDFEHYVDKYYSFWQRLLSPEEIKNVFQPI
WSKVEHISTKDIFSSVFRQHSVELTRPEDYVNHSLYFEAKTFLHGLLVVEDKLSMAHSLE
TRVPFLDNDLVDFAMKIPTRLKLGNLTEVIRLNENEPGNKTDKYFQKNKDGKLLLREVMS
NYIPKVLTERVKQGFSAPDASWFKGESIDYVRRTIENNHAKIYNFLDQSAVSQLVDEHLQ
GKANRRLLIWSLLNLEKWCSLFL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacaggtatactcaatctagatggcgatccagtatccccagtgatactc
aaaaaaatgacagatgcgatcgctcaccgaggcccagatggtgaaggacaatatatagat
aatggtcttggtcttggtcatcgtcgtctagctatcatagatttatctccggctggccat
caaccaatgtcaacaatcgatggtcagttgattatgacctacaacggagagatttataat
tttaacgaattacgcattgaattagaatctttaggctatcaatttcgttcccgcacagac
agcgaagtgctactttatgcttatgcagagtggagagaaaaatgcctggaacgattcaat
ggtatgtttgcctttgcaatttgggacaagcggcgaagagaattatttttagcacgcgat
cgctacggaattaaacctttatattacacaaacacaggcactaaatttatctttggttcg
gaagtcaaagccatcattgcacatcccgattatcctcgatctatagattttgagggatta
ctggaatatttgacatttcaaaatttcttaactgaaaaaactttatttaaagatataaaa
ctgttgcctgcgggaacatatatgtgtctatcattagacacgcaaaagtcagtacaacaa
caatattgggattatcattttgttgagccagataatcctttagatgacagagaatatcta
gaagaattagatagattatttcgccaagcaatcaatcgccaactaattagtgatgtcgaa
ttgggagcttatttaagcgggggaatagatagtggctcaattactgcgatcgcggcgcaa
caacttccctatattaaatcttttacttgtggttttgaccttaattccgcttctggtgtt
gaagtgagttatgatgagcgagaagctgctgaatatatgtcttatttattcaagactgaa
cactacgaaatggtcttgaaagctggtgatatggaacgagtaatgccgcgtttagcatgg
catttggaagaaccacgtgtaggacagagttatccaaatttttatgtagcccaattagcc
agtaaatttgtgaaagttgtccttgctggtactggcggagatgaactatttgcaggttat
ccttggcgctattaccgtgcagttgtcaatgatgattttgagcattacgttgataaatac
tatagtttttggcaacgattactatctccagaagaaattaaaaatgtttttcaaccgatt
tggtcaaaagtagagcatatttctactaaagatatttttagcagtgtgtttagacagcat
tcggttgagctaactcgtcctgaagattatgttaatcactctctttactttgaagctaaa
actttcttacatgggcttttagttgtggaagataaattgagtatggcgcattccttagaa
acgagagtaccatttctggataacgatttggtggattttgccatgaaaatccccacgcgg
ttaaaattgggcaaccttacagaagtaatcagattaaacgaaaatgaaccaggaaataaa
actgacaagtattttcaaaaaaataaagatggtaaattattgctccgcgaagtcatgagc
aactatattcctaaagttttaacggaacgagtcaaacagggattctctgcgcctgatgct
agttggtttaagggagaaagtattgattatgtgcggcgcacaattgaaaataatcatgct
aagatttacaattttttagatcaatcagccgtaagccaattagtcgatgagcatttgcaa
ggaaaggctaatcgccgcttattaatctggtcactgttgaatttagaaaaatggtgtagt
ctttttttataa

DBGET integrated database retrieval system