KEGG   Nostoc sp. PCC 7107: Nos7107_1204Help
Entry
Nos7107_1204      CDS       T02362                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7107_1204
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nos7107_1204
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Nos7107_1204
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Nos7107_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393631..1394740
Genome map
AA seq 369 aa AA seqDB search
MTKTIVVKIGTSSLTQPETGQLALSTIATLTETLCNLRQQGNRVILVSSGAVGVGCARLG
LTERPRAIALKQAVAAVGQGRLMRIYDDLFTTLQQPIAQVLLTRSDLVQRSRYLNVYNTF
QELLGLGVIPVVNENDTVAVEELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRS
VPDAKPISLVSNIKELAQLQIQTGGQGSQWGTGGMVTKISAARIAIAAGVRTVITQGRFP
RNLEKILQGEPLGTHFEPQPEPTSARKRWIAYGLVPSGKLYLDPGAIAAISQAGKSLLAA
GIKTVEGEFDNQAAVQLCDTNGNEIARGLVNYTSDELQKISGRHSREIPEILGYVGTDTV
VHRDNLVLT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacgattgtcgtcaaaatcggcacttctagccttacccaaccagaaacgggg
caattagcactttctacgatcgccactttaacagaaacactgtgtaatttaagacagcag
ggcaatcgagtgattttagtttcatctggtgctgtgggtgtgggttgtgccagattaggc
ttaaccgaacgccccagagcgatcgcgctcaaacaggcagtagccgcagttggtcaaggg
cggttaatgcggatatatgatgatttatttactaccttgcaacagccaattgcccaagtt
ttgctaactcgcagcgatttagtacagcgtagtcgatatcttaacgtttacaacaccttt
caagaactcttagggctgggtgtaattccggtagtgaatgaaaatgacaccgtggccgta
gaggaactgaaatttggtgataacgataccctgtcagcattggtggctagtttagtagaa
gcagattggctgtttttactcaccgacgtagacagattatactcagccgatccccgttct
gtacccgatgccaaaccaatttccttggtcagtaatattaaagaattagcacaactgcaa
atccaaacaggcggtcaaggttcacaatggggtactggtgggatggtaacaaaaatctcc
gccgcccgaattgcgatcgccgcaggagtgcgaacagtaatcacccaagggcgatttccg
cgcaatctggaaaaaattttacaaggggaacctttagggacgcactttgaaccgcaacca
gaacccacatcagctaggaaacgctggatagcttatggtttagtcccatctggtaaattg
tatttagatcccggtgcgatcgctgcaatatcccaagccggaaaatcattattagccgca
ggtatcaaaacagtagaaggagaatttgacaaccaagcggctgtgcagttgtgcgatact
aacggcaacgaaattgccagaggactagtaaactacaccagcgatgaattgcaaaaaatc
tctggtcgtcactccagagaaattcccgaaattttagggtatgttggcacagataccgta
gtgcatcgagataacttggttttgacttaa

DBGET integrated database retrieval system