KEGG   Nostoc sp. PCC 7107: Nos7107_1251Help
Entry
Nos7107_1251      CDS       T02362                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00340  Histidine metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Nos7107_1251
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Nos7107_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFY41901
UniProt: K9Q9U4
Position
1448767..1450050
Genome map
AA seq 427 aa AA seqDB search
MQLLKTTDTDFSTAFQALVNNRREATVDVSGTVRGILADVKVRGDAAVKEYTRRFDHFSP
ESLHLSADFIAAQAAKCPADVRIALELAAERIGSFHQKQLPQDISYTDATGVKLGLNWIS
LSQVGIYVPGGRASYPSSVLMNALPAKIAGVERIVMTVPMPHGEINPAVLAAAQVAGVTE
IYSIGGAQAVAALAYGTETLTPVDKIVGPGNAYVAEAKRQVFGTVGIDSIAGPSEILVVA
DDQNNPEWIAWDLLSQAEHDPSAQSILITDSEVFAQQVITAVELVLTKLSTQEVATASWQ
NHGAIIVVSDLAESIPLLNQLAPEHVELCVDNPQLLASQIKCAGSVFLGRYTPEAIGDYL
GGPNHVLPTSRSARFASGLSVYDFLKRITYLECNQAALQEIGKAAVTLADAEGLPAHAGS
VAIRLQS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagctacttaaaacaactgacacagatttttccaccgcattccaagcacttgtcaat
aatcgccgggaagccacggttgatgttagtggtacagtacgcggcattttggctgatgta
aaagtgcgaggtgatgccgcagttaaggaatatactagacgttttgaccatttcagccca
gaatctttgcatctgagtgccgattttatcgccgcccaagccgccaaatgtccggctgat
gtgagaatcgccttggaattagccgcagaacgcatcggtagctttcaccaaaaacaactg
ccccaagatattagttacaccgacgcaacaggagtgaaactcggtttaaattggatttct
ctctcccaagtggggatttatgtccccggtggacgcgccagctatcccagttcggtgttg
atgaatgccctcccagctaaaattgccggggtggaacgcattgtgatgacagtaccaatg
cctcatggggaaattaacccggctgtgttagcagcggcgcaagtggctggtgtaacggaa
atatatagtattggtggggcgcaagcagtagccgccctcgcctatggtacagaaactcta
acgcctgtagataaaattgttggccctggtaatgcttatgttgcggaagccaagcgtcag
gtatttggaactgtgggtattgacagcatcgctggcccttcagaaattttggtggtggct
gatgatcaaaataacccagagtggatagcttgggatttattatcgcaagcagaacatgac
cccagcgcccaatcaatcttaattactgattcggaagttttcgcccagcaagttatcaca
gcagttgaattagttctcaccaagctgtctactcaagaggtagcaacggctagttggcaa
aatcatggggcaattattgtagttagtgatttggcagaaagtatcccactcttgaatcaa
ttggctcctgaacacgtcgagttatgtgtagataacccgcaattactcgccagtcaaatt
aaatgcgccggtagtgtgtttttaggacgctacaccccagaagccattggcgattatttg
ggtggccccaaccatgtattaccaacttcccgttcggcgcggtttgcttctgggttgagt
gtgtacgatttcctcaaacgcattacttatttagaatgcaatcaagccgcgttgcaagaa
attggtaaagctgcggtgactttagctgatgcggaaggtttgccagcccatgctgggagt
gtggctattcgtttgcaatcataa

DBGET integrated database retrieval system