KEGG   Nostoc sp. PCC 7107: Nos7107_1408Help
Entry
Nos7107_1408      CDS       T02362                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nos  Nostoc sp. PCC 7107
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nos03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630265..1630822
Genome map
AA seq 185 aa AA seqDB search
MQRLPGVGPKSAQRLALHILKRPEAEVEALAQALVDAKKQIGLCSVCFHLSAEPVCEICR
NPNRDNQTICVVADSRDVIALEKTREYKGKYHVLGGVISPMDGIGPEQLNIQPLVRRVSQ
QKPQEVILAISPSIEGETTTLYIGQLLKPFTKVTRIAFGLPVGGDLEYADEVTLARALEG
RRELD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgtctaccaggagtaggccccaaatcagcccagcgactggctttgcacattttg
aagcgaccagaagcagaagtagaggctctggcgcaagcgttggttgacgcaaaaaaacaa
ataggcttgtgttcagtctgctttcacttatctgcggagccagtttgtgaaatctgccgc
aatcccaaccgcgacaatcaaaccatctgcgttgtagctgattcgcgggatgtgattgcg
ctggaaaaaacccgcgaatacaaaggtaaatatcacgttttaggtggagtgatttcccca
atggatggaattggcccagaacagttgaatatccaacctttggtgcgacgggtgagtcag
caaaaaccccaagaagtgattttagcaatcagtccgagtatagaaggggaaaccaccaca
ctgtatattggtcaactactaaaaccttttacaaaggtgacacgaattgcctttggttta
cctgtaggtggagatttagagtacgccgatgaagtaaccttggccagagccttagaagga
cggcgagagttagattag

DBGET integrated database retrieval system