KEGG   Nostoc sp. PCC 7107: Nos7107_1444Help
Entry
Nos7107_1444      CDS       T02362                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nos02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669498..1670493)
Genome map
AA seq 331 aa AA seqDB search
MRIAIVNDMRIVVEALRRMLATIPEYDLAWVAYDGAEAVSKCAVDTPDLILMDVLMPCMD
GVEATRQIMSQSPCAIIIVTANVNLYAANVLEAMTYGALDAINTPAEGSTGLLKKIATIA
KLIGKSPQLRTVKKPRLFPKLFPPLIVIGASTGGPQALVQILAQFPPNFPAAVVIVQHLD
AQFAPGFATWLNEQILLSVEIASIGSRPQPGKILLAGTNHHLVMNSNLSFDYHEQPSNCL
YRPSIDVLFKSVAEHWMDQGIGVLLTGMGKDGAQGLKLLREAGWHTIAQNQETCIVYGMP
KAAVDLKAAVEVLPVEAIAHACTKILRMSAN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgccattgtcaacgatatgcggatagtggtagaagcattgcggcggatgtta
gccacaatcccagaatatgatttggcttgggttgcctacgatggtgcagaagctgttagc
aaatgtgctgttgatacccctgatttaattttgatggatgttttgatgccttgcatggat
ggagtggaagccacaaggcaaattatgagtcagtcgccttgtgcaattatcatcgtcact
gccaatgtgaatttgtatgcagctaatgttttggaagctatgacctatggggcgttagat
gctatcaatacacctgctgagggtagtacaggtttattaaagaaaattgctaccatcgcc
aaattaattggcaaatcccctcaactgcgaacagtgaaaaaacctagacttttccccaaa
ttattcccaccacttattgtcattggtgcttccactggcggccctcaagccttggttcag
attctcgcgcaatttcccccaaattttccggcggctgtagtgattgtgcagcatttagat
gctcagtttgcaccaggttttgcaacttggttgaatgaacaaattctcttatctgtggaa
atagccagtataggttcaagaccacaaccaggaaaaattctcttagctgggacaaatcat
catctcgttatgaattctaacttgagttttgactatcatgaacaaccatccaattgtctt
tatcggccatccattgatgtcttattcaaaagtgtggcagaacattggatggatcaagga
attggggtgttgctgactgggatgggaaaagatggcgctcaaggtttaaaactcttgcgc
gaagcaggctggcatacaattgctcaaaaccaagaaacttgcattgtttatggtatgccg
aaagcagcggtagatttaaaagctgccgtggaagttttgccagttgaggcgatcgctcat
gcttgcaccaagatattacggatgtcggcaaattaa

DBGET integrated database retrieval system