KEGG   Nostoc sp. PCC 7107: Nos7107_1444Help
Entry
Nos7107_1444      CDS       T02362                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:nos00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nos7107_1444
Enzymes [BR:nos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nos7107_1444
Two-component system [BR:nos02022]
 CheA family
  WspE-WspRF [MD:M00509]
   Nos7107_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669498..1670493)
Genome map
AA seq 331 aa AA seqDB search
MRIAIVNDMRIVVEALRRMLATIPEYDLAWVAYDGAEAVSKCAVDTPDLILMDVLMPCMD
GVEATRQIMSQSPCAIIIVTANVNLYAANVLEAMTYGALDAINTPAEGSTGLLKKIATIA
KLIGKSPQLRTVKKPRLFPKLFPPLIVIGASTGGPQALVQILAQFPPNFPAAVVIVQHLD
AQFAPGFATWLNEQILLSVEIASIGSRPQPGKILLAGTNHHLVMNSNLSFDYHEQPSNCL
YRPSIDVLFKSVAEHWMDQGIGVLLTGMGKDGAQGLKLLREAGWHTIAQNQETCIVYGMP
KAAVDLKAAVEVLPVEAIAHACTKILRMSAN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgccattgtcaacgatatgcggatagtggtagaagcattgcggcggatgtta
gccacaatcccagaatatgatttggcttgggttgcctacgatggtgcagaagctgttagc
aaatgtgctgttgatacccctgatttaattttgatggatgttttgatgccttgcatggat
ggagtggaagccacaaggcaaattatgagtcagtcgccttgtgcaattatcatcgtcact
gccaatgtgaatttgtatgcagctaatgttttggaagctatgacctatggggcgttagat
gctatcaatacacctgctgagggtagtacaggtttattaaagaaaattgctaccatcgcc
aaattaattggcaaatcccctcaactgcgaacagtgaaaaaacctagacttttccccaaa
ttattcccaccacttattgtcattggtgcttccactggcggccctcaagccttggttcag
attctcgcgcaatttcccccaaattttccggcggctgtagtgattgtgcagcatttagat
gctcagtttgcaccaggttttgcaacttggttgaatgaacaaattctcttatctgtggaa
atagccagtataggttcaagaccacaaccaggaaaaattctcttagctgggacaaatcat
catctcgttatgaattctaacttgagttttgactatcatgaacaaccatccaattgtctt
tatcggccatccattgatgtcttattcaaaagtgtggcagaacattggatggatcaagga
attggggtgttgctgactgggatgggaaaagatggcgctcaaggtttaaaactcttgcgc
gaagcaggctggcatacaattgctcaaaaccaagaaacttgcattgtttatggtatgccg
aaagcagcggtagatttaaaagctgccgtggaagttttgccagttgaggcgatcgctcat
gcttgcaccaagatattacggatgtcggcaaattaa

DBGET integrated database retrieval system