KEGG   Nostoc sp. PCC 7107: Nos7107_1490Help
Entry
Nos7107_1490      CDS       T02362                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nos00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nos00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723700..1725205)
Genome map
AA seq 501 aa AA seqDB search
MKLRELLAVVGNVAQLPNNPDLADAEVKGLKTNSHACGEGDLFIGMPGTRVDGGEFWPSA
IASGAVAAIVSAEAAEKNPPTPEAVVISASDMNQACAQIAAAFYDYPGQKLKLVGVTGTN
GKTTTTHLIEFLLNKAHLATALMGTLYTRWPGFVQTAIHTTPFAVELQQQLAAAVNAGCE
FGTMEVSSHALAQGRVLGCPFEVGVFTNLTQDHLDYHSDMEDYFAAKALLFSPEYLKGKA
VINADDSYGKQLIARLPSEQVWSYSVSDRHADLWMSDLNYQPNGVSGVLHTPKGEVAFRS
PLVGQYNLENVLAAVGAVLHLGLDLELIAAAISDFPGVPGRMERVQIEPNQEISVIVDYA
HTPDSLENLLKAARPFIPGKMICVFGCGGDRDRTKRPKMGKIAAELADVAVITSDNPRTE
DPEKILQDVLAGIPDTVQPTVICDRATAIRTAILQALPGDGVLLAGKGHEDYQILGTEKI
HFDDREHAREALLSRQGKPEV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcgggaattactagcagtagtaggaaatgtggcacaattgccgaacaatcct
gatttagcagatgcggaagttaaggggttaaaaactaactcccatgcttgcggtgaggga
gatttatttattggaatgccaggaacgcgggtagacggtggcgaattttggccaagtgcg
atcgcttctggtgcagtagcggcgatcgtttctgccgaagctgccgaaaaaaatcctccc
acgccggaggctgtagtgattagtgctagtgatatgaatcaagcttgcgcgcaaatagca
gcggctttttacgattatcccggacaaaaactcaaattagtgggtgtgaccggcactaac
ggtaaaactaccactactcacctgattgaatttctcctgaataaagctcatctcgctacg
gctttgatggggactttatacactcgctggccgggttttgtgcagactgctattcacact
acgccttttgcggtggaactacaacagcagttagcagccgccgtcaatgctggttgtgag
tttggcacaatggaagtcagttctcacgcattagcgcaaggccgagttttgggttgtccg
tttgaggtgggagtatttaccaatctcacccaagaccatctggactatcacagcgatatg
gaggattatttcgcagcgaaggcgttgttatttagccccgaatatctcaaaggaaaggca
gtaatcaacgctgatgactcctacggtaaacaattaatcgcccgattaccatcagaacaa
gtttggagttacagtgtcagcgatcgccatgctgatttgtggatgagcgatttaaattat
cagcccaatggtgtgagcggtgttttacatacacccaagggtgaagtagcttttcgctca
ccattggttggtcaatataatttagaaaatgttttggctgcggtgggtgcagttctccac
ttaggactagatttagagttaatcgccgctgcaattagtgattttcctggtgttcccggc
cggatggaacgagtgcaaattgagccaaaccaagaaatcagcgtgattgtggattatgcc
catacccccgatagcttagaaaacttactcaaagctgcacggccgtttattcccggtaaa
atgatttgcgtgtttggttgtggtggcgatcgcgatcgcactaaacggccaaaaatgggt
aaaatcgccgcagagttagcagacgtggctgttatcacttccgacaatccccgcacagaa
gacccagaaaaaattctgcaagatgttttagctggaatccccgacaccgtgcaaccgact
gtaatttgcgatcgggcgacagctattcgtaccgcaattttacaagctctacccggcgat
ggagtattgttagcgggtaaaggtcatgaagactatcaaattctcggtacagaaaaaatc
cactttgatgaccgagaacacgcacgggaggctttattgtccagacaaggaaaacctgaa
gtgtga

DBGET integrated database retrieval system