KEGG   Nostoc sp. PCC 7107: Nos7107_1672Help
Entry
Nos7107_1672      CDS       T02362                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Nos7107_1672
Enzymes [BR:nos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Nos7107_1672
Transporters [BR:nos02000]
 Other Transporters
  Pores ion channels [TC:1]
   Nos7107_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AFY42313
UniProt: K9QAD1
Position
1936041..1936679
Genome map
AA seq 212 aa AA seqDB search
METLRLYDFLPSGNGYKIRLLLSQMGIPYERIEVNILKGESRTPEFLSKNPNGKIPILEV
EAGKYLTESNAILAYLSEYTEFLPYDRFLKAQVFQWLFFEQYSHEPYIATSRFWISILGK
AEEYQAALAQKQEPGYAALSVMEKHLQSHLYFVGDRYTIADIALFAYTHVADEGGFDLSR
FPAIQRWIERVKAQPRYISITYQPMPQETEFC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgctacgtttgtacgattttttaccctctggtaatggctataagatacgtctt
ttattatcacaaatgggtattccctatgaaagaatcgaggtgaatatcttgaagggagaa
agtcggacacctgaattcttaagtaagaatcctaatggcaagatacctattttggaagtt
gaagcaggaaagtacttaacagaatcaaatgccatattggcttatctcagtgaatacaca
gaatttttaccttacgatcgctttttaaaagcacaggtttttcaatggttattttttgaa
caatacagtcatgaaccgtatattgccacatccagattttggatttccattttaggcaaa
gcagaagaatatcaggcggctttagcacaaaagcaggaacctggttatgcagcattaagt
gtgatggaaaagcatttgcaatctcatctatattttgttggcgatcgctatacaattgct
gatattgctttattcgcttatacccatgtagccgatgaaggtggctttgatttatccaga
tttccagctattcaaagatggatagaacgcgttaaagctcaacctcgatacatcagcatt
acatatcagccaatgcctcaagaaactgagttttgctaa

DBGET integrated database retrieval system