KEGG   Nostoc sp. PCC 7107: Nos7107_2037Help
Entry
Nos7107_2037      CDS       T02362                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00020  Citrate cycle (TCA cycle)
nos00640  Propanoate metabolism
nos00660  C5-Branched dibasic acid metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01130  Biosynthesis of antibiotics
nos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nos7107_2037
   00640 Propanoate metabolism
    Nos7107_2037
   00660 C5-Branched dibasic acid metabolism
    Nos7107_2037
Enzymes [BR:nos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nos7107_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AFY42661
UniProt: K9QBX6
Position
2349743..2350966
Genome map
AA seq 407 aa AA seqDB search
MDLLEYQVKEWFGNIGIPVLPSQRIDHPTDLKRLKIHYPIVLKSQVYAGERIHAGGVRIV
ETTIDAIAAAQTIFNLPIWGQLPEVLLAETRYDSKQEFYLAVVLDTAVCRPVLLGCKEAD
IDWESAGEKLQYVVVEQEFSPFYARRLALKMGLQGALMQSVSNVVEKMYELFIQKDLDLV
EINPLAVNAANEVMALNGKVSINERAIGRHPELAELATKISNRYSSNKHNPRLKDGNAGD
TQGKIGILGNGAGSIMATFDLVVSLGGKPSHPLNLRHGLLTDILPTSFGDRLAKGLNLLA
ADKSIQVILINLLGSIPQAEATAQVIAKFIQDHSEPERTHSSRSRQELSLPCLVVRLAGS
ELNVAKDLLATLENQGEIVLVEDLDEAVAQAIRLAKPATYQSVKVKR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatttattagaatatcaagttaaagaatggtttgggaacataggtattcctgtcttg
ccatctcaaaggatagatcatcctacagatctcaaacgcttaaaaattcattatcccatt
gtcctcaaatcccaagtatacgcaggcgaaagaattcacgctggtggagtcagaattgtt
gaaacaactattgatgcgatcgccgcagcccaaactatttttaatttgccaatttggggt
caattaccagaagttttattggcagagactagatatgatagcaaacaagaattttatttg
gcagtagttttagatacagctgtttgccgaccagtacttttaggttgtaaagaagcagat
atcgattgggaatcagcaggagagaaattacagtatgtggtggtggaacaagaattttcg
cctttttatgcgcgacgactagctttgaaaatgggtctgcaaggtgcgctgatgcagtct
gtcagcaacgttgtggaaaagatgtatgagttatttatccaaaaagatttagacttagta
gaaattaatcctttagcagtgaatgcagcgaatgaggtgatggccttaaatggcaaagtc
agcattaacgaacgggctattggtcgtcatccagaactggctgaattagccacaaaaatt
agcaaccgttacagcagcaacaaacataaccctaggttgaaagatgggaatgctggagac
acccaaggcaaaatcgggattttgggtaatggtgcaggttcgattatggctacctttgat
ttagtcgttagtcttgggggtaagcccagtcatccgttgaatctacgacatggtttatta
actgatattttgcccacaagttttggcgatcgcctagctaaaggactgaatctcctcgct
gctgacaaaagcattcaagttattctgattaacctccttggtagtattccccaagccgaa
gctaccgcacaagtaattgccaaatttattcaagatcatagtgaacctgaacgtactcat
agcagccgcagtcgtcaggagttatctcttccttgcttagttgtgcgcttggctggttcg
gaattgaatgtagccaaagatttattagccaccttagaaaatcaaggtgaaattgtcttg
gtagaagatttagatgaagcagtagcgcaagctattcgtctggctaaaccagctacttat
caatctgtcaaggttaaacgttaa

DBGET integrated database retrieval system