KEGG   Nostoc sp. PCC 7107: Nos7107_2185Help
Entry
Nos7107_2185      CDS       T02362                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nos7107_2185
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nos7107_2185
Exosome [BR:nos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nos7107_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2548362..2549870)
Genome map
AA seq 502 aa AA seqDB search
MESTSPSSGYILALDLGTTGNRAFVFNKAGQIVGQAYKELTQYYPQPGWLEHDPEEIWRD
TCWVMENAIAQAQISPSQIAALGLTVQRETCLIWDKTTGKPLHKAIVWQDRRTAPLCHQL
QTQGYAVEIYDRTGLVIDAYFSATKLRWLLDKVTGVDLNNVLAGTIDTWVLWKLTAGKVH
ATDHSNASRTMLMNLKTCAWDEILLEILQIPAQILPQIQPSLGKFGVTDKTLLGVEIPIT
AILGDQQAALFGHGCDRPGLMKCTYGTGSFLVAHTGSEIVRSPHQLISTLAWTQNHSGNL
EIGYALEGSMFTSGACIQWLRDGIKLIKTAAETETMANQVADNGGVYFVPAFSGLGAPYW
DMNARGAFFGITASVQPQHLVRAVLEAIAYQVFEVVQAINACSPTPMKRLIVDGGACENN
FLMQFQADVLGIPVERPKMRDTTVQGAAFAAGLAAGFWDSYTTLVSQRQIDRIFEPNQAR
NNALANFATWQKAVKRSLDWAE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagtacatctccatcatcaggctatatcttggctttggacttgggtacaacaggc
aaccgtgcttttgtatttaacaaagcaggtcaaattgttgggcaagcatataaagaactc
acacagtattatccccaaccgggctggttagaacatgatcccgaagaaatttggcgagat
acctgctgggtaatggaaaatgcgatcgcccaagcgcaaatttcgccatcacaaatagcc
gccttgggattgactgtacagcgggaaacttgcttaatttgggataaaaccactggtaaa
cccctacataaagctattgtttggcaagaccgccgcactgcacctctttgtcatcaatta
caaacacaaggttatgcagtagaaatttacgatcgcactggtttggtgattgatgcttat
ttttcggcgacaaagttgagatggttattagacaaagttacaggcgttgatttaaacaat
gttttggcaggtacgattgatacttgggtattgtggaaattaactgcgggaaaagttcat
gcaaccgaccacagtaacgccagccgcaccatgttaatgaacctaaaaacctgcgcctgg
gatgaaatattactcgaaatcttgcaaattccggctcagattttgccgcagattcaaccc
agcttaggcaaatttggtgtgacagataaaaccttgttgggtgtagaaattcccatcaca
gctattttaggcgaccaacaagcagcattatttggtcatggctgtgatcgccctggttta
atgaaatgtacttatggtactgggagctttttggtagcccatactggatcagaaattgtg
cgatcgccacatcaactgatttccactttggcttggacgcaaaaccacagcggtaattta
gagattggctatgctttagaaggcagtatgtttactagtggtgcctgtatccaatggtta
cgggatggcatcaaactgattaagactgcggcagaaacagaaacaatggctaaccaagtt
gccgataacggcggcgtgtactttgtccctgcctttagtgggctgggtgcgccttattgg
gatatgaatgctagaggagccttttttgggattaccgccagcgtccaaccccaacattta
gtgcgggctgttttagaagcgatcgcttaccaagtttttgaagttgtgcaagccattaat
gcttgttctcccacgccaatgaagcggttaattgtcgatggcggcgcttgtgaaaacaac
tttctcatgcagttccaagctgatgttttgggcattcccgtagaacggccaaaaatgcgc
gatacaacagtacaaggtgcagcatttgccgctggtttagcagctggattttgggacagc
tacacaacactagttagtcaacggcaaatagaccgcatctttgaacctaatcaagcgagg
aataacgccttagccaactttgccacttggcaaaaagcagttaagcgtagcttggattgg
gcagagtaa

DBGET integrated database retrieval system