KEGG   Nostoc sp. PCC 7107: Nos7107_2922Help
Entry
Nos7107_2922      CDS       T02362                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nos00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:nos00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:nos02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3408856..3410430)
Genome map
AA seq 524 aa AA seqDB search
MDFINCDRLLSNRYKRRSVLLGAGFFTGLALTSQWKPALATSRFSSYPFTLGVASGDPLP
DSVVLWTRLAPDPLNGGGMPPRNVVVHWEVALDENMRKVVRRGKTLAIADLAHSVHVDVQ
GLDSNRWYWYQFRVGNELSPIGRTRTAPAFHSYIKQLNYAFVSCQDWQNGFYTAYRHLAE
EDIELVVHLGDYIYEYGPETNGPRQHNSPEIMTLTDYRDRHALYKTDPNLQAVHAAFPWI
VTWDDHEVENNYANLISEDNVNPEIFAQRRTNAYKAYYEHMPLRLSSFPNGANLQLYRRL
NYGNLAQFHVLDTRQYRTDQPCNDGLQLRCVQAYDENATMTGSLQERWLFNGLDRSRARW
NIIAQQTMFAQFDFDPRPEIGLFNLDQWDGYVAARNRIVNYLNYRRPSNPVVITGDIHSS
WVHDIKLDFNNPASVTVATEFVGTSITSDFPTSFIAPVQAALRSNPHTKFFDGAFRGYVR
CQVTPKQWQSDYRAVSSIVDPNASISTLASFVVQDGQPGAYRQA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggattttatcaattgcgatcgcctattatcaaatcgttataaacggcggagtgtttta
ctgggtgcgggattttttacaggtttagcattaaccagccaatggaaaccagcattagca
acatcgagattttctagctatccctttaccttgggtgtagcgtctggcgacccattacca
gatagtgtggtgttatggacaaggttagcaccagaccctctgaatggtggtggaatgcca
ccgagaaacgtggtggtacactgggaagtcgctctagatgagaatatgcgaaaagttgtc
cgacgtggtaaaactttagcgatcgcagatttagcccattcagtacacgttgatgtgcaa
ggtttagactctaaccgttggtattggtatcagttccgcgtcgggaatgaacttagcccc
atcggacgaactcggacagcaccagcattccatagttacatcaaacaactaaactatgct
tttgtttcttgccaagattggcaaaatggcttttacaccgcctaccgccatctagctgaa
gaagatattgaattagttgtccatctgggtgattatatttacgagtatgggccagaaact
aacgggccacgtcagcataatagcccagaaattatgactctgaccgactaccgcgatcgc
cacgcactttataaaactgacccaaatcttcaagcggttcatgcagcctttccttggata
gtcacctgggatgaccatgaagtagaaaacaactacgccaacttaatttctgaagataac
gtcaacccagaaatctttgcccaacgccgcactaacgcctataaagcgtactacgaacac
atgccattgcgtttgtcttcctttcctaatggtgcgaacctccaactttatcggcgcttg
aattatgggaatttagctcagtttcacgttttagatacccgtcaatatcgcacagatcaa
ccttgtaatgatggactccagctgcgttgtgtgcaagcctatgacgaaaatgccacaatg
acaggctcactgcaagaacgctggctattcaacggtttagaccgatcccgcgcccgttgg
aatattattgcccagcagacaatgtttgctcaatttgattttgaccctcgcccagaaatc
ggattattcaacttagatcaatgggatggttatgtagccgcacgtaatcgaattgtgaac
tatctcaactatcgccgaccttctaaccctgtagtgattacaggtgatatccattccagt
tgggtacacgacatcaaacttgattttaataatcctgcttccgtaactgtggcaactgag
ttcgtcggtacttccattacctccgactttcccacctcatttattgcacccgtacaagcc
gccttgagaagtaatccccataccaaatttttcgatggtgcatttcgcggttacgtccgt
tgccaagtcactcccaaacagtggcaaagtgattatcgggcagtttctagcatcgttgac
cccaatgcttctatcagcaccctagcttccttcgttgtccaagatgggcaaccaggagca
tatcgacaagcttaa

DBGET integrated database retrieval system