KEGG   Nostoc sp. PCC 7107: Nos7107_2963Help
Entry
Nos7107_2963      CDS       T02362                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nos7107_2963
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Nos7107_2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3462199..3463119)
Genome map
AA seq 306 aa AA seqDB search
MSIIVFGSINIDLVATAPHLPTSGETLLGNDFFQVPGGKGANQAVALARLGIPTQMVGRV
GSQGFGAELLNNLQTAGVQTENILLDETVSSGIAIIIVDDAGQNQIVVIPGANGKVNQAD
VERLSPLLPTAKALLLQLEIPLSAVVAAAKAGRNANITVILDPAPAQSNLPAELYPLVDI
ITPNEVEAGQLVGFAVDSPESAAKAGAVLLQKGVKSAIVKLGAKGVVCTTTEETFFVPAF
SVNVVDTVAAGDAFNGGLAAALYTGMTLHQAVIWGATAGALATTKLGAQTSLPDRFTFEA
FLKEKV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtattattgttttcggcagtatcaatatagatttagtagccacagcaccccattta
ccaactagcggtgaaactttgctgggaaacgatttttttcaagtcccaggggggaaaggt
gcaaatcaagcagtagcattagcacggttgggaattccgactcagatggtggggcgggtg
ggaagccaaggttttggtgcagagttactgaataatttacaaactgctggcgtacaaact
gaaaatattttattagatgaaacggtaagttcgggaattgccatcattattgttgatgat
gctgggcagaatcaaattgtggtgattcctggtgctaatggaaaagtaaatcaggcagat
gtagagaggttatcgcctttattaccaacagctaaagcactgcttttacaattagaaatt
cctctgagtgctgttgttgcagctgctaaagctggacgcaatgccaatattacagtaatc
cttgatcctgcaccggctcaatctaacttacctgccgaactttacccgttggtggatatt
atcacccccaatgaggtagaagcaggacaattagttggttttgcggtggatagcccagaa
tcagcagccaaagcaggggcagtgttattgcaaaaaggggtgaaatctgcgatcgttaaa
ttaggtgcaaagggtgtggtatgtaccacaactgaggaaacattttttgtgccagctttt
tcagttaatgttgtggatactgtggcggctggtgatgcttttaatggtggtttagcagct
gcactttatacaggaatgactttacatcaagcagtgatttggggtgcaaccgcaggtgct
ttagccacgacaaaattaggcgcacaaacttcgttacctgataggtttacgtttgaggct
tttcttaaggaaaaagtatga

DBGET integrated database retrieval system