KEGG   Nostoc sp. PCC 7107: Nos7107_3198Help
Entry
Nos7107_3198      CDS       T02362                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Nos7107_3198
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nos7107_3198
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Nos7107_3198
Lipid biosynthesis proteins [BR:nos01004]
 Desaturase
  First
   Nos7107_3198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3694431..3695285
Genome map
AA seq 284 aa AA seqDB search
MTAKYLAVAPETGNSPRLRWVNVAFFATIHVLALLAPWFFSWSALGLLVFLHWLFGSIGI
CLGYHRLLSHRSFQVPKWLEYAIALIGALALQGGPIFWIGGHRQHHAHTEDINLDPYSAK
RGFWWSHLLWIMYPRSEFFDYEIYKKYAPDLERQPYYRWLDRYFLLLQIPLGILLYALGG
WSFVVYGMFVRAVLLWHSTWFVNSASHIWGYRTFDANDEARNLWWVSLLTHGEGWHNNHH
TFPHVAKAGFQWWEIDITWWSIKTLKALGLAKKVILPPAQARQR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaaatatctggcggttgctcctgagacaggaaattcacctcgcctgagatgg
gtgaatgtggctttttttgctactattcatgtcttagctctgttggctccttggtttttt
tcttggtcagcgctaggattgctggtgtttctccattggctgtttgggagtattggcatt
tgcttaggatatcatcgactgttaagccatcggagtttccaagtacccaagtggttagaa
tatgcgatcgccttgatcggagccttagcacttcaaggtggtccgattttttggattggt
ggacaccgccagcaccacgcccatacagaagatatcaacttagatccttactctgccaag
cggggattttggtggagccatctactatggattatgtatccccgttctgagttttttgat
tatgaaatctataagaaatatgcgcctgacctggaaagacaaccttactatcgctggtta
gatcgctactttttattattgcaaattcccttgggaatattgctgtatgctttgggcggt
tggtcttttgtagtttatggaatgtttgtccgtgcagtcttattgtggcactccacttgg
tttgtcaattctgcatcacatatttggggttatcgtaccttcgatgccaatgatgaagca
cgtaatttgtggtgggtatcgctgctaactcatggagaaggttggcacaacaaccatcat
acttttcctcacgtagccaaagctggtttccagtggtgggaaattgatatcacttggtgg
agtattaaaactttaaaagcattgggtttagcgaaaaaagttatcttaccaccagcacaa
gcacgtcaaagatga

DBGET integrated database retrieval system