KEGG   Nostoc sp. PCC 7107: Nos7107_3219Help
Entry
Nos7107_3219      CDS       T02362                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7107_3219
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nos7107_3219
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nos7107_3219
Enzymes [BR:nos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nos7107_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3714517..3715608)
Genome map
AA seq 363 aa AA seqDB search
MTVSLSVAKSHRQPWPGLIEAYREYLPVSDNTPIVTLLEGNTPLIPVPAIAERIGRQVSV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYAKRGGMNAFVLI
PDGYVALGKLAQALLYGAEVLAIQGNFDRALEIVREMAESYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNISAYWMGFCQYHQAGKCDRLPKMMGFQAAGAAPLVN
GKPVAHPETIATAIRIGNPASWDKAIAAQTASQGTFQAVTDAEILNAYRLLAASEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSDSKFKQGIPAELTAVATA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgagcttgtctgttgctaaatctcatcgccaaccttggcccggactgatagaa
gcctatcgtgagtacttacctgtcagtgacaatacacccattgttaccttgttagagggc
aacactcccttgattccggtgccggcgatcgcagaacgcattggtagacaagtcagcgta
tttgtcaagtacgacggtctcaacccaacaggcagttttaaagaccgagggatgacaatg
gccatatccaaggccaaggaagctggcgcaaaagcagtaatttgcgcgagtacaggtaac
acttccgccgccgccgccgcttatgccaaacgtggggggatgaatgcttttgttttgatt
cctgatggttatgtagctctgggcaaattagcgcaggctttattatatggagcagaagtc
ctggcaattcaagggaattttgaccgcgccttagaaattgtccgggaaatggccgagagc
tatcccataactttagtcaattccgttaatccctaccgtttagaaggacaaaaaaccgga
gcttttgaagtagttgatgctctgggtaacgctcccgattggttatgtatccctgtgggt
aatgccgggaatatatcagcatattggatgggattttgtcaatatcatcaagctggtaaa
tgcgatcgcctgcctaaaatgatgggatttcaagccgcaggtgcagcacccttagttaac
ggtaaaccagtcgcccatcccgaaaccatcgccacagccattcggattgggaatccggct
agttgggacaaagcgatcgcggctcaaactgctagtcaaggaacttttcaagccgtcact
gatgccgaaattctgaatgcttatcggcttttggctgcatctgaagggattttctgtgaa
ccagccagcgccgcttctgtagccggattattaaaagtcaaagaccaagtacccacaggt
gcaacagtggtttgtgtactgacaggtaatggactcaaagatccagatacagccattaag
catagtgatagtaaatttaagcaaggtatccccgccgaattaacagctgtagccacagca
atgggattttaa

DBGET integrated database retrieval system