KEGG   Nostoc sp. PCC 7107: Nos7107_3219Help
Entry
Nos7107_3219      CDS       T02362                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7107_3219
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nos7107_3219
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nos7107_3219
Enzymes [BR:nos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nos7107_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3714517..3715608)
Genome map
AA seq 363 aa AA seqDB search
MTVSLSVAKSHRQPWPGLIEAYREYLPVSDNTPIVTLLEGNTPLIPVPAIAERIGRQVSV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYAKRGGMNAFVLI
PDGYVALGKLAQALLYGAEVLAIQGNFDRALEIVREMAESYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNISAYWMGFCQYHQAGKCDRLPKMMGFQAAGAAPLVN
GKPVAHPETIATAIRIGNPASWDKAIAAQTASQGTFQAVTDAEILNAYRLLAASEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSDSKFKQGIPAELTAVATA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgagcttgtctgttgctaaatctcatcgccaaccttggcccggactgatagaa
gcctatcgtgagtacttacctgtcagtgacaatacacccattgttaccttgttagagggc
aacactcccttgattccggtgccggcgatcgcagaacgcattggtagacaagtcagcgta
tttgtcaagtacgacggtctcaacccaacaggcagttttaaagaccgagggatgacaatg
gccatatccaaggccaaggaagctggcgcaaaagcagtaatttgcgcgagtacaggtaac
acttccgccgccgccgccgcttatgccaaacgtggggggatgaatgcttttgttttgatt
cctgatggttatgtagctctgggcaaattagcgcaggctttattatatggagcagaagtc
ctggcaattcaagggaattttgaccgcgccttagaaattgtccgggaaatggccgagagc
tatcccataactttagtcaattccgttaatccctaccgtttagaaggacaaaaaaccgga
gcttttgaagtagttgatgctctgggtaacgctcccgattggttatgtatccctgtgggt
aatgccgggaatatatcagcatattggatgggattttgtcaatatcatcaagctggtaaa
tgcgatcgcctgcctaaaatgatgggatttcaagccgcaggtgcagcacccttagttaac
ggtaaaccagtcgcccatcccgaaaccatcgccacagccattcggattgggaatccggct
agttgggacaaagcgatcgcggctcaaactgctagtcaaggaacttttcaagccgtcact
gatgccgaaattctgaatgcttatcggcttttggctgcatctgaagggattttctgtgaa
ccagccagcgccgcttctgtagccggattattaaaagtcaaagaccaagtacccacaggt
gcaacagtggtttgtgtactgacaggtaatggactcaaagatccagatacagccattaag
catagtgatagtaaatttaagcaaggtatccccgccgaattaacagctgtagccacagca
atgggattttaa

DBGET integrated database retrieval system