KEGG   Nostoc sp. PCC 7107: Nos7107_3837Help
Entry
Nos7107_3837      CDS       T02362                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7107_3837
Enzymes [BR:nos01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Nos7107_3837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4474763..4478434
Genome map
AA seq 1223 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAAVAESRCPDLDIRVFSDRDIISKRGEVETALHDADVFF
GSLLFDYDQVVWLRDRLAQVPIRLVFESALELMSLTKLGDFAIGDKPKGMPKPVKFILDK
FSNGREEDKLAGYISFLKIGPKLLKFVPVQKVQDLRNWLIIYGYWNAGGPENVASLFWTL
AEKYLGLKIGDIPPPVETPKMGLLHPDYQGFFASPKAYLDWYQQRGRRQEAGGRRNAFQP
PIVGILLYRKHVITKQPYIPQLIRRFEEAGLIPLPIFINGVEGHVAVRDWMTTDYEQQQR
QLNNIETPSLSPDAVKVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILTAKNVPYIVAA
PLLIQDIHSWTRQGVGGLQSVVLYALPELDGAIDTVPLGGLVGENIYLVPERVQRLIGRV
KSWVALRQTPASERKIAIILYGFPPGYGAAGTAALLNVPRSLIKFLHALKDQGYNVGDIP
EDGEELIRQVKEADERIETNSSPLPNTVNARQLEKWLGYLRTSRVEKQWKSLTSSGIKTY
GEELHIGGVQLGNVWIGLQPPLGIQGDPMRLMFERDLTPHPQYAAFYKWLQNELQADAVV
HFGMHGTVEWLPGSPLGNTGYSWSDILLGDLPNLYIYAANNPSESILAKRRGYGVLISHN
VPPYGRAGLYKELVALRDLIAEYREDPKKNYVLKEGICKKIVDTGLDVDCPFEDAKKLGI
PFTPENIRMFSAHAFDDYLVKLYEYLQVLENRLFSSGLHTLGEAPNEEEMAAYLEAYFGN
EPQRRGEEEIQIRDLLEQTTDELTNLLRGLNGEYIPPAPGGDLLRDGAGVLPTGRNIHAL
DPYRMPSPAAYERGREIAQKIIAQHLQEHGKYPETVAVLLWGLDAIKTKGESLGILLELV
GAEPVKEGTGRIVRYELKPLAEVGHPRIDVLGNLSGIFRDSFVNIIELLDDLFLRAAEAD
ESEEQNFIRKHALALKAQGVENVSARLFSNPAGDFGSLVNDRVVDGNWESGEELGNTWQS
RNVFSYGRQDKGQARPEVLNQLLKTSDRIVQEIDSVEYGLTDIQEYYANTGGLKKAAEKQ
SGKKVTTSFVESFSKDTTPRNLEDLLRMEYRTKLLNPKWAQSMANQGSGGAYEISQRMTA
LIGWGGTADFQDDWVYDQAADTYALDPEMAEKLRQANPEAFRNIISRMLEASGRGFWEAD
QDKLDKLRQLYELTDEELEGVTV
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatcgtcttaattgctgggtttgaatcgttcaacgctgacttatacagaaaa
gcggctgctgtggctgaatctcgctgtcctgatttagatattcgggtgtttagcgatcgc
gatattatcagtaaacgtggggaagtagaaacagcactgcatgacgctgacgtatttttt
ggcagcttattatttgattatgaccaagttgtgtggctgcgcgatcgccttgcccaagtt
cccatccggcttgtgtttgagtcagctttagaattgatgagtttaaccaagttgggagac
tttgccattggggacaaacccaaaggaatgcccaaaccagttaaattcatcctcgacaaa
ttcagtaatggacgggaagaagacaaactcgcaggttacatcagcttcttaaaaatcggc
ccgaaacttctcaaattcgtcccagtccagaaagtccaagacttacgcaactggttaatt
atctatggttactggaatgctggcggccccgaaaacgtcgcttctttattctggacacta
gcagaaaaatacctcggcttaaaaattggcgacattcccccaccagtcgaaacccccaaa
atgggattattgcatcccgactatcaagggttttttgcatcgccaaaagcctacctagac
tggtatcagcagagaggcaggaggcaggaggcaggaggcagaaggaatgcttttcagccc
cccattgtggggatattactttaccgcaaacacgtaatcaccaagcaaccctatattccc
caactcattcgccgctttgaagaagccggtttaattcccttacctatattcatcaacggt
gtagagggacacgtagcagttcgggactggatgacgactgactacgaacaacaacaacgc
caacttaataatattgaaactccctcactttccccagatgcagttaaagttgatgccata
gtttccaccattggctttccccttgtcggtggcccggctggttcaatggaagccggtcgc
caagtagaagtagcaaagcgcatcctgactgcaaaaaatgtcccttatattgtcgccgca
cccttattaattcaagatatccattcttggacacgccaaggtgtcggcggattacaaagt
gtagttttatatgcgttacccgaacttgatggggctattgataccgttcccctcggtggt
ttggtaggcgaaaatatttatcttgttcctgaacgggtacagcgattaattggtagagtc
aaaagctgggttgctttacggcaaacaccagcatcagaacgtaaaattgccattatttta
tatggtttcccccctggttatggtgcagccggcacagctgcattgttgaatgtacctcgc
agtttaattaaattccttcacgcactcaaagaccaaggttataacgttggcgacatcccc
gaagatggggaagaattaattcgtcaggtgaaagaagccgacgagagaatagaaacaaat
tcctccccactccccaatactgtaaatgcccgtcaattagaaaaatggttgggatatctc
cgcacatctcgcgttgaaaaacaatggaaatctttaacaagtagtgggattaaaacttat
ggtgaggaactgcacattggtggtgtgcagttaggaaatgtctggataggtttacaacca
ccgttaggcattcaaggcgacccgatgcgattaatgtttgaacgcgatttaacaccacat
ccccaatatgctgctttttataaatggttacaaaacgagttgcaagctgatgctgtggtt
cactttggaatgcacggcacagtggaatggttgccgggttcgcctttaggaaatacgggt
tattcttggtcggatattttgttaggtgatttgcccaatctatatatatatgcggcgaat
aatccttcggagtcaattttggcaaagcgtcgcggttatggggtgttaatttcgcacaat
gtcccgccttatggtcgtgcaggtttgtataaggaattggtggcgttgcgcgatttaatt
gcggagtatagagaagacccgaaaaagaattatgtgctgaaggaagggatttgtaaaaag
attgttgatacgggtttagatgttgattgtccgtttgaggatgcgaaaaagttgggcatt
ccttttacgccagaaaatatcagaatgtttagcgcccatgcttttgatgattatctggtg
aagttgtacgaatatttgcaggttttggagaatcgtttgttttcctctgggttacatact
ttgggtgaagcgccaaatgaggaagagatggcggcttatttggaggcttattttggaaac
gaaccgcaaagacgcggagaggaagagatacagataagagatttattagaacaaactaca
gatgagttaacaaatttattgcgggggttgaatggggagtatattccgcctgcgcctggt
ggtgatttgttgcgtgatggggcgggggttttgccgacgggaaggaatattcatgcgtta
gatccttatagaatgccttcacctgcggcgtatgaaagaggtagggaaattgcccagaaa
attatcgcccagcatttacaggaacatgggaagtatcctgaaactgtcgcagttttgttg
tggggtttagatgcgattaaaactaagggtgaatctttaggaattttgctggagttggtt
ggtgctgaacctgtgaaggaagggactggccgaattgttcgttatgaattgaaacccttg
gctgaggtgggacatccccgcattgatgtgttgggtaatttgtcgggaattttccgagat
agttttgtgaatatcatcgaattattggatgatttgtttttacgcgcggctgaggcggat
gagtcggaagaacagaattttattcggaaacacgctttggctttaaaagcgcaaggtgta
gaaaatgtttccgcgagattgttttctaatcctgcgggtgattttggttctttagtaaat
gatagggtggtggatgggaactgggaatctggggaagagttaggtaatacttggcaaagc
cgcaatgtgtttagctatgggagacaagataaaggccaagctagaccagaggtgttgaat
cagttattgaaaacgagcgatcgcattgtccaagaaatcgattcggtagaatatggttta
actgatattcaggaatattacgccaacactggcggcttgaaaaaagccgccgaaaaacaa
agcggtaaaaaggtaactaccagctttgtcgaaagtttctcaaaagacaccaccccccgc
aatttagaagatttgctgcggatggaatatcgtaccaaattactcaatcccaaatgggcg
caatcaatggcaaatcaaggttctggcggtgcttatgaaatctcgcaacggatgacagcc
ttaattggttggggtggtactgccgattttcaagatgattgggtttatgaccaagcggct
gatacctacgctttagacccagaaatggcagagaaattacgccaagccaaccctgaagct
ttccgcaatattattagcagaatgttagaagcatctggacgcggtttctgggaagctgat
caagataagttagataaattgcgtcagttatatgagttgactgatgaagaattggaagga
gtgactgtttaa

DBGET integrated database retrieval system