KEGG   Nostoc sp. PCC 7107: Nos7107_4013Help
Entry
Nos7107_4013      CDS       T02362                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nos00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4691095..4692603)
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPTSFPSRFGIGDLGLEAYKFIDFLRESYQQYWQVLPLGPTGYGNSPYA
AYSAMAGNPFIISPEKLQEKGLLSDEDFANLPEFNNSQVDYDKVIAIKTPLLKKACKNFQ
NQATPLQQTEFAGFCDSKAYWLDDYALFMALKDANEGTSWHTWEAALVKREPAAIEQVKQ
QLNAEIFYYKFIQFEFFREWSELKAYANMSGIQIIGDIPIYVAQDSSDVWSHPEIFCLDE
ETREPKLMAGVPPDYFSATGQLWGNPVYNWEELQKQNFKWWIGRFEAMLDYLDVIRIDHF
RGFEAYWAVPQGEETAINGEWVKAPGEELFDAIKEALGKLPVLAEDLGVITPEVEALRDK
YEFPGMKVLQFAFGSDPGNPFLPFNYSQNFVVYTGTHDNDTTVGWFDKANDYEKRNFLLY
LGCISPEGVHWDLIRLALSSVANQAIIPLQDVLGLATDARMNFPSVAEGNWGWRYHSDVL
TREVSDRLKTLTQLYGRAPQQK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcccagatccagcggcattttgctgcatcctacctcattccccagccgattt
ggtattggtgatttaggcttagaagcctataagtttattgattttctcagagaaagctac
cagcaatattggcaagttttgcctttggggccaactggttatggtaattctccttacgct
gcttattctgcaatggcgggtaatcccttcatcattagccctgaaaagctgcaagaaaaa
ggtttactatcagacgaagactttgctaacctgccagaatttaacaattctcaggtagac
tacgacaaagttatagcaattaaaactccactgctcaaaaaagcctgcaaaaattttcaa
aaccaagcaacacctctacaacaaactgaatttgccggtttttgtgacagcaaagcttat
tggttagatgattatgccttatttatggcgctgaaagatgcgaatgaggggacaagctgg
catacgtgggaagcagcactagtcaagcgtgaaccagccgcaattgagcaagtaaaacag
cagttaaatgcggaaattttttattacaaattcatccaatttgaatttttccgcgaatgg
tcggaactcaaagcttatgccaatatgagcggtattcaaattattggcgatattcccatt
tatgtagctcaagatagctctgacgtgtggtcgcatcccgaaatcttttgtctggatgaa
gaaaccagagaaccgaaactaatggccggagttccaccagattattttagtgctactggt
caattgtggggcaacccggtttacaactgggaggaattgcaaaaacagaactttaagtgg
tggataggtcgctttgaagcgatgttggattatttagatgtaatccgcattgaccacttt
cgaggatttgaagcttattgggctgttccccaaggtgaagaaactgcgattaatggcgag
tgggtgaaagcgcctggggaagaattgtttgatgctattaaagaagctctaggtaaacta
cctgtcttagctgaagatttaggagtaattacgccagaagtagaagcactccgcgacaaa
tatgaatttccggggatgaaggtgttacagttcgcctttggttctgatcccggtaatcca
tttttaccttttaactactcgcagaatttcgtagtttataccggaacccatgataatgac
acaacagtgggctggtttgacaaagctaatgattacgaaaaacgcaactttttactttat
ttaggttgtattagtcctgaaggtgtgcattgggatttaattcgtctggctttaagttcc
gttgctaatcaagcaattattccgttgcaggatgttttaggcttagcaactgatgcgcgg
atgaatttccctagtgtggctgaaggtaattgggggtggcgctatcattcagatgtactt
accagagaagtaagcgatcgcttaaaaactctcacccaattatacggtcgtgctcctcaa
caaaaatga

DBGET integrated database retrieval system