KEGG   Nostoc sp. PCC 7107: Nos7107_4076Help
Entry
Nos7107_4076      CDS       T02362                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nos01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nos00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4766118..4767419
Genome map
AA seq 433 aa AA seqDB search
MLRIITQQADVKAELQRICDRTQDEQVVHKEATVREVLQAVKRQGDKAVLHYTAEFDNQT
LKLEELRVTGSELDKAYQQVSQELLQAIQLAARQIEAFHRQRIPKSWVNFGEDDVVLGKR
YTPVDRAGIYVPGGRAAYLSTVLMNAIPAKVAGVPRVVMVTPPGAGKVISPAVLVAAQET
GVQEIYRVGGAQAIAALAYGTETIPKVNIITGPGNIYVTLAKKLVYGTVGIDMLAGPSEV
LIIADEFANPVHVAADMLAQAEHDPMAAAILLTTDPALAKNVQVAVERQLVDHPRRIDTE
KAIAHYGLIVLVESLEAAAELSNEFAPEHLELEVKDPWAILPQIRHAGAIFLGYSTPEAV
GDYLAGPNHTLPTSGAARYTSALSVETFLKHSSIIQYSPTALQKVAGAIDALATAEGLPS
HADSVRRRIQQDE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattactcagcaggcagacgttaaagcagaactacaacgtatctgcgat
cgtacccaggacgaacaggtagttcacaaagaagcaactgtgcgggaagtgttgcaagct
gtgaagcgccaaggcgacaaagcagtgttgcattacacggctgaatttgacaaccaaacc
ttgaagttggaagaactgcgtgttacgggttctgaactagataaagcataccaacaagta
tctcaagaattgctccaagcaattcagttagctgctcgtcaaattgaagcatttcaccgt
cagcgaatccccaaaagttgggtaaactttggggaagatgatgtagtgttgggtaaacgc
tacacccctgtagatcgagccgggatatatgtccctggtggtcgtgcagcttatctgagt
acggtgttgatgaacgccattccagcaaaagtggctggtgtaccacgagttgttatggta
acaccaccaggcgcagggaaagtcattagcccagctgtactagtagcagcccaagaaaca
ggagtacaagaaatttatcgcgttgggggagcgcaggcgatcgcggctttagcttacggt
acagaaacaatcccgaaagtcaatataattactggcccaggcaatatttacgtcacctta
gccaaaaaactcgtctatggcaccgtgggcattgatatgctggcggggccaagcgaagtg
ctaatcattgccgatgaatttgctaatccggtgcatgtggctgctgatatgttagcccaa
gccgaacatgatccaatggcagcagcgattttactgaccactgatccagctttggcaaaa
aatgtccaagtcgctgtggaaagacagttagttgatcatcccaggcggatcgatacagaa
aaagcgatcgcccactacggtttaattgtgctggtagaatctttagaagcagcagcagaa
ctctccaatgaatttgctccagaacacttagagttagaagttaaagacccttgggcaatt
ctgccccaaatccgccacgctggggcgatatttttaggttattccacaccagaagctgtc
ggtgactatttagcagggcctaaccatacattgcccacttctggcgctgcccgctatact
tcggcattaagcgtagaaaccttcctcaaacactctagtattattcaatactcacccact
gccttgcaaaaagtagcgggtgcaattgatgctctcgccacagcggaaggcttaccttcc
catgctgattcagtccggcggcggattcaacaagatgagtaa

DBGET integrated database retrieval system