KEGG   Nostoc sp. PCC 7107: Nos7107_4076Help
Entry
Nos7107_4076      CDS       T02362                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7107_4076
  Amino acid metabolism
   00340 Histidine metabolism
    Nos7107_4076
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Nos7107_4076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4766118..4767419
Genome map
AA seq 433 aa AA seqDB search
MLRIITQQADVKAELQRICDRTQDEQVVHKEATVREVLQAVKRQGDKAVLHYTAEFDNQT
LKLEELRVTGSELDKAYQQVSQELLQAIQLAARQIEAFHRQRIPKSWVNFGEDDVVLGKR
YTPVDRAGIYVPGGRAAYLSTVLMNAIPAKVAGVPRVVMVTPPGAGKVISPAVLVAAQET
GVQEIYRVGGAQAIAALAYGTETIPKVNIITGPGNIYVTLAKKLVYGTVGIDMLAGPSEV
LIIADEFANPVHVAADMLAQAEHDPMAAAILLTTDPALAKNVQVAVERQLVDHPRRIDTE
KAIAHYGLIVLVESLEAAAELSNEFAPEHLELEVKDPWAILPQIRHAGAIFLGYSTPEAV
GDYLAGPNHTLPTSGAARYTSALSVETFLKHSSIIQYSPTALQKVAGAIDALATAEGLPS
HADSVRRRIQQDE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattactcagcaggcagacgttaaagcagaactacaacgtatctgcgat
cgtacccaggacgaacaggtagttcacaaagaagcaactgtgcgggaagtgttgcaagct
gtgaagcgccaaggcgacaaagcagtgttgcattacacggctgaatttgacaaccaaacc
ttgaagttggaagaactgcgtgttacgggttctgaactagataaagcataccaacaagta
tctcaagaattgctccaagcaattcagttagctgctcgtcaaattgaagcatttcaccgt
cagcgaatccccaaaagttgggtaaactttggggaagatgatgtagtgttgggtaaacgc
tacacccctgtagatcgagccgggatatatgtccctggtggtcgtgcagcttatctgagt
acggtgttgatgaacgccattccagcaaaagtggctggtgtaccacgagttgttatggta
acaccaccaggcgcagggaaagtcattagcccagctgtactagtagcagcccaagaaaca
ggagtacaagaaatttatcgcgttgggggagcgcaggcgatcgcggctttagcttacggt
acagaaacaatcccgaaagtcaatataattactggcccaggcaatatttacgtcacctta
gccaaaaaactcgtctatggcaccgtgggcattgatatgctggcggggccaagcgaagtg
ctaatcattgccgatgaatttgctaatccggtgcatgtggctgctgatatgttagcccaa
gccgaacatgatccaatggcagcagcgattttactgaccactgatccagctttggcaaaa
aatgtccaagtcgctgtggaaagacagttagttgatcatcccaggcggatcgatacagaa
aaagcgatcgcccactacggtttaattgtgctggtagaatctttagaagcagcagcagaa
ctctccaatgaatttgctccagaacacttagagttagaagttaaagacccttgggcaatt
ctgccccaaatccgccacgctggggcgatatttttaggttattccacaccagaagctgtc
ggtgactatttagcagggcctaaccatacattgcccacttctggcgctgcccgctatact
tcggcattaagcgtagaaaccttcctcaaacactctagtattattcaatactcacccact
gccttgcaaaaagtagcgggtgcaattgatgctctcgccacagcggaaggcttaccttcc
catgctgattcagtccggcggcggattcaacaagatgagtaa

DBGET integrated database retrieval system