KEGG   Nostoc sp. PCC 7107: Nos7107_4145Help
Entry
Nos7107_4145      CDS       T02362                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nos  Nostoc sp. PCC 7107
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7107_4145
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Nos7107_4145
Enzymes [BR:nos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nos7107_4145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4843670..4844758
Genome map
AA seq 362 aa AA seqDB search
MPVSRELELFGNHVILGVSGTKLSDDDKRALSELKPVGVIFFAKNFIDGVPYQVWLASFQ
ELIDQIREYAERDSMFMTLDHEGGRVVRTPLPITRFPYAALLRSQAKEVAKATARELKSL
GINVSWSPVADVYSNPHNPIIGPRAFGNTPETAAQGALAYYLGLQESGILGCAKHFPGHG
DTSTDSHFELPVLNLTVQDLRDRELIPFKALIDAQVPLIMTTHILFPQIDPDVPATISQR
ILKNILRDELGFEGVVVSDDLDMKAVSDRFTQSGTVARAFNAGCDLFILSRNINSSSLER
TYYMAGDFADALSNGNLKKEVVTAASQRIENLLAQTPQYIVHALDKATLLQHAELAIACS
FS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccagtatcacgggagctagaactattcggaaatcatgtaattctaggtgtttccggc
acaaaattaagtgatgatgataaacgggcgctcagtgaattaaaaccagttggggtgata
ttttttgcgaaaaactttatagatggtgttccttatcaggtttggttagccagctttcaa
gaactcatagaccaaattcgtgaatatgcggaacgtgattcaatgttcatgacgttagat
catgaaggtgggcgtgtagtccgtacacccttaccaattacgagatttccttatgctgcg
ttgttgcgatcgcaagctaaagaagtagcaaaggccacagcacgagagttgaaatcactg
ggaattaacgtatcttggtcgcctgttgctgatgtttattctaatccgcataacccgata
attgggccgcgtgcctttggtaacacgccggaaacagcagcacaaggagcgttggcatat
tatttagggctacaagagtctggtattttaggatgtgccaagcattttccgggacatgga
gacaccagtacagattctcattttgagttaccagtactaaatttaactgtacaagatttg
cgcgatcgcgaactgatacctttcaaagctttgattgatgctcaagttcctttaattatg
acaactcacattttatttccccaaattgacccagatgtcccggcgactatttcgcaacgg
attttgaaaaatatccttcgggatgaactagggtttgagggtgtagttgtctctgatgac
ttggatatgaaagcagtttccgataggtttacccaaagtggaaccgtcgcccgcgctttt
aacgctgggtgtgacttgtttattctctcgcggaatatcaactcatcgtctttggaacgc
acttattacatggcgggggattttgctgatgcgctcagtaacggtaacttaaagaaagag
gtagttacagctgctagtcagagaattgaaaatttactagcacagacaccccaatatatt
gtccatgctttagataaagctacattactacaacacgcggagttagcgatcgcttgttct
ttctcataa

DBGET integrated database retrieval system