KEGG   Nostoc sp. PCC 7107: Nos7107_4221Help
Entry
Nos7107_4221      CDS       T02362                                 

Definition
uroporphyrinogen-III C-methyltransferase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nos00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4920384..4921955)
Genome map
AA seq 523 aa AA seqDB search
MTEKLGKVYLVGAGPGDVAYLTVKAYHLLAVAEVLVYDALVDEQLLQCVPANCLRLDVGK
RGGKPSTPQGEINKLLVQHCQSGQQVVRLKSGDPFIFGRCTAEIAALKAAGCEFEVIPGI
SSALAAPLFAGIPLTDPVMSRCFAVFTAHEPDALDWEALSRLETLVILMGGQNLPEILHQ
LLRRKRSPLTPIAIIRWAGTPNQQIWTGQLNNILEKTAGLSLSPVVIVIGEVVGLRQYLQ
SETINSEDFTTAIIPSFANMSNHLPLAGKTILVTRSVGQSSEFSDRLQAVGATVMEMPTL
EIGPPSSWADLDRAIASLSDFHWLILTSTNGIEYFFARLTALGKDSRALANVKIAVVGEK
TAQCLRQQALKPDFIPPNFVADSLVENFPEALLGQKILFPRVETGGREVLVKELTAKGAE
VVEVAAYQSCCPSSIPESAKLALQNHQIDIITFASSKTVQFFCQIIDNTFANNSVVNLQD
VCIASIGPQTSKTCHTLFGRVDVEAEEYTLEGLTQALVKKYEV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaactgggtaaagtttaccttgtaggtgcagggccgggagatgtggcgtac
ctgacagtcaaggcttatcatctcttggctgtggctgaggtgttggtctacgatgctttg
gtagatgagcaattattacagtgcgtaccagcgaattgtttaaggttagatgtgggtaag
cgtggtggtaaacccagtacaccccaaggggaaattaataaattattggtgcagcactgc
caaagtggtcaacaagttgtcaggttaaaatcaggcgacccgtttatttttggccgctgt
actgctgaaattgcagcattgaaagccgctggttgtgagtttgaagtgataccgggaatt
tcttcggctttagcagcgcccttgttcgccggaattcccttgacagacccagtgatgagt
cggtgttttgctgtgtttaccgcccatgaaccagatgcgttggactgggaggcgctgtca
aggttagagacattagtaattttgatggggggacaaaatctaccagagattttacatcaa
ttattgcggcgtaagcgatcgcctctcactcccattgcgatcatccgctgggcgggaacg
ccaaatcaacaaatttggactggtcaactcaataatattttagaaaaaaccgcagggtta
tcactctcaccagtggtaattgtcattggtgaagttgttggtctacggcagtacttacaa
tctgagacaataaattctgaggattttactacagcaattattcccagttttgcaaatatg
tccaaccacctccccctcgctggaaaaactatcttagtcactcgttctgtgggacagtcg
agcgaatttagcgatcgcctccaggcggttggtgctacagtgatggaaatgcccacgtta
gaaatcggcccgccttctagttgggcagatttagatcgtgcgatcgctagtttatctgac
tttcactggttaattctcacctcaaccaacggtattgaatacttttttgccagattaaca
gccttgggtaaagattctcgtgctttggctaatgtcaaaattgcagtagttggggagaaa
acagcccaatgtctcagacaacaagccctaaaaccagattttattccccctaactttgtc
gcagactcgttggtagaaaactttcccgaagcattgttaggtcaaaagattttattcccc
agagtagaaactggcggtcgagaagttttagtcaaagaattaacagccaagggcgcagaa
gttgttgaagttgcagcatatcaatcttgctgtcctagtagtatcccagaatcagcaaag
ttagctttacaaaatcatcaaatagatattattacatttgctagttctaaaactgtacaa
tttttctgtcaaattatagacaacacatttgctaataactctgttgtcaatttacaggat
gtttgcattgcttccattggccctcaaacgtctaaaacttgtcatactttattcggacgg
gtagatgttgaggctgaagaatataccctagaagggctaactcaagccttggtgaaaaag
tatgaagtgtga

DBGET integrated database retrieval system