KEGG   Nostoc sp. PCC 7107: Nos7107_4501Help
Entry
Nos7107_4501      CDS       T02362                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Nos7107_4501
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Nos7107_4501
Enzymes [BR:nos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Nos7107_4501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5241703..5244111)
Genome map
AA seq 802 aa AA seqDB search
MTNQHSPEIPEYTWNRPIGLGWDKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHIFQNVPACQFSVFESYGTSSQAYALSTQSLEDGSLNAWQWYPASSESTST
GTYHALYPRSWFVYENVFQSQLTCEQFSPIWANNYQETSYPVAVFLWKAHNPSNAPITLS
IMLTWENMVGWFTNALKSPEVKIRDDGSPVYEYQPRWGESQGNYNQVVENSEYFGCFLGR
VGITAPVQEGDGSWCIATVKHPQVEIFHHSKWHPEGTGDEVWQSFAADGSLPNYLDTNPV
GENQRLGSAIAVRFNVQPGETLEIPFVLAWDCPVTEFAAGVNYYRRYTDFFGKDGNQAWE
IATTALGNYQTWRSQIQSWQAPILNREDLPAWFKMALFNELYDLTSGGTLWSAASEIDPI
GQFAVLECLDYRWYESLDVRLYGSFGLLLLFPELEKSVMRAFARGIPQSDDHQRIIGYYY
TIGADTTTAARKVAGATPHDLGAPNEHVWEKTNYTCYQDCNLWKDLSCDFVLQVYRDYLL
TGADDVEFLADCWDAVVQTLDYLKTFDKDGDGIPENSGAPDQTFDDWRLLGVSAYCGGLW
LAALEAAIAISDILITNHKVVESAEKQKSIYEVWLAQSRPIYQEKLWNGQYYRLDSESGS
AVVMADQLCGQFYARLLELPDIVPSDRALSALKTVYDACFLKFQNGEFGAANGVLPDGSP
ENPKATHPLEVWTGINFGLAAFLVQMGMQDEALRLTQAVVEQVYNNGLQFRTPEAITATG
TFRASTYLRAMAIWGIYLVMSK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaacactctccagaaattcctgaatacacttggaatcgtcccatcggctta
ggctgggacaaaccttatacagtccgctatgccagtaatattgatgatggcccttggcat
ggtatgcctttgggtggttttggtgcaggttgcattgggcgttcttctaggggggatttt
aacctatggcacatcgatggcggtgagcatatcttccaaaatgtgcctgcttgtcaattc
agtgtgtttgagtcttatggtacatcttctcaagcctacgctttatctactcaatcacta
gaagatgggagtctcaatgcttggcaatggtatccagcgagtagtgagtcaacttccaca
gggacttatcatgctttatacccgcgcagttggtttgtatatgaaaatgtgtttcaatca
cagctaacttgtgagcagttttcgccaatttgggcaaataattatcaagaaacgagttat
cctgtggcggtgtttttgtggaaggcgcataaccccagcaatgcaccgattaccctcagc
attatgctgacttgggaaaatatggtgggctggtttactaatgcgttgaagtcgccagaa
gtcaagatccgcgatgatggtagcccagtttatgaatatcaaccgcgctggggtgaaagt
caggggaattacaatcaagtagtggaaaattccgaatattttggttgttttttaggcagg
gtgggaattactgcacctgtacaagaaggtgacgggagttggtgtattgcaacggtaaaa
catccccaagtcgaaatttttcaccacagtaaatggcatcctgaaggtacgggtgatgag
gtatggcaaagctttgcggctgatggttctttacctaattatctagatactaatccagta
ggagaaaatcaacgcctaggaagtgcgatcgcagttcgctttaatgtccaaccaggggaa
actttagaaattccctttgtgttggcttgggattgtccagtcacagaatttgctgcgggg
gtgaattattaccgtagatatacagatttttttggtaaagatggtaatcaagcctgggaa
attgcgactactgctttaggaaattatcaaacatggcgatcgcaaattcaaagttggcaa
gccccaattctcaaccgcgaagacttgccagcctggttcaaaatggcgttatttaacgaa
ttatacgacttaactagcggtggtactctctggagtgcagcatcagaaatcgatcctatc
ggccaatttgcggtgttggaatgtttagattaccgctggtatgaaagtttagatgtgcgg
ttatatggttcctttggcttgctgctactatttcccgaattagaaaagtcggtgatgcgg
gcgtttgcacggggaattccccaaagcgatgaccatcaacggattattggctactactat
accattggtgcagatacgacaactgccgcccgtaaagttgctggtgccacaccccacgat
ttaggcgcacccaatgaacacgtttgggagaagacgaattacacctgttatcaagactgt
aatttgtggaaggatttaagctgcgatttcgttttgcaagtttaccgcgattatttgctg
actggtgctgatgatgtcgagtttttagcagattgttgggatgcagttgtgcagactctc
gactacctgaaaacttttgacaaagatggtgatggaattcctgaaaattcaggcgcacca
gaccaaacttttgatgattggcggttactgggggtgagtgcttattgtggcgggttgtgg
ttggctgctttggaggcggcgatcgctattagtgatattttaataacgaaccataaagta
gtagagagcgcagagaaacaaaagtctatctatgaggtatggttagcgcaatctcgtcct
atctatcaggaaaagttgtggaacgggcaatattatcggttagatagtgagagtggttct
gctgtggtgatggcagatcaattatgtgggcaattttatgcccgattactagagctacca
gatattgtaccgagcgatcgcgctttatctgccctgaagactgtttatgatgcttgcttt
ttgaaattccaaaacggtgaatttggtgcggcgaatggtgtgcttcccgatggttcacca
gaaaaccccaaggctacccatcctttagaagtttggacagggatcaattttggattagcg
gcgtttcttgtgcagatgggaatgcaggatgaagctttgcggttgacacaagctgtagtc
gagcaagtttataacaacggcttgcaattccgcacacccgaagccattaccgccaccggg
actttccgcgccagtacttacctccgggcgatggcgatttggggtatttatttagtaatg
agtaaatag

DBGET integrated database retrieval system