KEGG   Nostoc sp. PCC 7107: Nos7107_4609Help
Entry
Nos7107_4609      CDS       T02362                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nos00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nos7107_4609
Enzymes [BR:nos01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Nos7107_4609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5367824..5368459)
Genome map
AA seq 211 aa AA seqDB search
MISYLKGIIAGVQTNNGNRVILTLEVNGIGYDLQVPQRLAQQLPESGGVAQIFTHYQIRE
EVPLLYGFASPAERDLFRHLLTVSGIGAALAIALLDTLELPDLVQAIIASNTQILIQAPG
VGKKTAERICLELKSKLIEWRKSAGFFVATGGPAPGILEEVQMTLFALGYTAHEVSHALH
VVSEDIGLPKDAYVEDWIKQAIAHLSSEQVQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattagctatctcaaaggtattattgctggcgttcagacaaataacggtaatcgcgtc
attctgactcttgaagtcaatggtatcggttacgatttgcaagttccgcaacgcttggca
cagcagctgccagaatcaggaggggtggcgcaaattttcacccattaccaaattcgggaa
gaagtgcctttactctacggctttgcgtctccagcagaacgggatttatttcgtcacttg
ctaacagttagtgggattggtgcggcgttagcgatcgccctcttagacactttggaatta
cctgatttagtccaagccatcattgccagtaacacccaaatcttaattcaagcccctgga
gtgggcaaaaaaaccgcagaacgcatctgtttagaactcaaaagcaagttgattgagtgg
cgcaaatcagccgggttcttcgtcgctacaggcggcccagcaccagggattttggaagaa
gtgcaaatgactttatttgccttgggttatacagcccacgaagtcagccacgccttacac
gtcgtcagcgaagacattggactacccaaagatgcctatgtggaagattggattaaacaa
gcgatcgcccacctcagcagtgaacaagttcaatag

DBGET integrated database retrieval system