KEGG   Nostoc sp. PCC 7107: Nos7107_4623Help
Entry
Nos7107_4623      CDS       T02362                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01130  Biosynthesis of antibiotics
nos01230  Biosynthesis of amino acids
Module
nos_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nos7107_4623
Enzymes [BR:nos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nos7107_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG T3SS_needle_F
Motif
Other DBs
NCBI-ProteinID: AFY45152
UniProt: K9QK03
Position
complement(5381991..5382848)
Genome map
AA seq 285 aa AA seqDB search
MIYPMTTVNSHLQPMLREIVWQKKQEVAQIQQHMSLASLQRQLTAAPTVRDFLTALQQSP
HNPSLIAEIQKASPGYGMIRADFDAIAIAKAYQRAGAACISVFTERTFFQGSFESLRIIR
HKVSVPLLCKEFIIDPCQIYLARAAGADAVLLIAAILTDRQLQDFQRIIHYLGMNALIEV
HTLAELDRVLQLDDVRLIGINNQSLVDFTVDIGTTQRLLAARRSQIQNLGAIVVSESGLY
THTDLSLMAEAGTNAVLIGESLIKETDIEQAVRRLLNIDSSTFKD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatttatccgatgactactgtgaattctcatctccaaccgatgttaagagaaattgtg
tggcagaaaaagcaagaagtagcacagattcaacaacacatgtctttagcttctttgcaa
cgtcagttaacagctgcgccaacagtacgagatttcttaacagctttacaacaaagtcct
cataatcctagtctgattgcagaaattcaaaaagcatcacctggttatggcatgattcgt
gcagactttgatgctattgcgatcgccaaagcatatcaacgtgctggtgctgcttgtatt
tctgttttcactgaaagaacattttttcaaggtagttttgaaagtctgcggataattcgc
cacaaagtatcagtaccactgctttgcaaagagtttattattgatccctgccaaatttat
ttagcacgagccgcaggtgcagatgcagttctactaatagccgcaattcttacagatagg
caactgcaagattttcaacgcataattcattatttagggatgaatgccttaatagaagta
cataccctagcagaacttgatcgggtattgcagttagatgatgttcggttgattgggatt
aataaccagagtttagtagattttaccgtggatatcggcacaactcaaagactactagca
gccaggcgatcgcaaatccaaaacttaggtgcgatcgtcgtgagtgaatcaggattgtac
acccatactgatttatcccttatggctgaagccggtaccaacgccgttttaatcggagaa
tctttaatcaaagaaacagatatagaacaagctgtacgccgtttgctgaatattgattct
tcaacgttcaaagactag

DBGET integrated database retrieval system