KEGG   Nostoc sp. PCC 7107: Nos7107_4935Help
Entry
Nos7107_4935      CDS       T02362                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nos00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5772797..5773354)
Genome map
AA seq 185 aa AA seqDB search
MLKLYGGAFSRAAIAKWYLEELQVPYEFVQLDMQAGAHRQPEYLQINPMGKVPAIVDGDF
QLWESGAILLYLHEKYGKSPTSLEERAEIYQWVLFANSTLASGIFTESTREREVPLLLTP
LNEIFQQQHFVLGDEFSVADVAVGSVLAYIPMMLKLDLSAYPAVLEYINRISERPAFKKG
IGGKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaactttacggcggtgcttttagccgggcggcgatcgccaaatggtatctagaa
gaattacaagttccctatgagtttgttcaactagatatgcaggctggcgcacatcgtcag
ccagaatatttgcagattaacccgatgggtaaagtcccggcaatagttgatggtgatttt
cagctttgggaatcgggagcaattttgctgtatttacatgaaaagtatggcaaatctcca
acttctctagaggaacgtgcagaaatatatcaatgggtgttgtttgctaactctaccctc
gcatcaggcatttttacagaatctaccagagagcgagaagtacccctattgttaactccg
ctgaatgagatttttcaacaacaacacttcgtattgggcgatgaatttagtgttgcggat
gtggctgtgggatcagttcttgcttatatacccatgatgctaaaactagacctcagcgcc
tacccagcagttctagaatatatcaaccgcatatctgaacgcccagcgtttaaaaaagga
attggtggaaagccttaa

DBGET integrated database retrieval system