KEGG   Nostoc sp. PCC 7107: Nos7107_5061Help
Entry
Nos7107_5061      CDS       T02362                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nos  Nostoc sp. PCC 7107
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nos7107_5061
Enzymes [BR:nos01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nos7107_5061
Exosome [BR:nos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nos7107_5061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5913128..5914786
Genome map
AA seq 552 aa AA seqDB search
MANSIEFTLFAPYNKGAALIASFSDWQEISMKKGEDGYFRTTVELEDGVYQYKFRVQSKS
WFFEADQWVEVTDPYATDIDELGSKDNSVIRIKDGKKIVDTYVWHHDDKSLPADHELVIY
ELHVGDFSGGEDDPYARGKYKHVIEKLDYLCELGINAIELLPVKEYPGDHSWGYNPRYFF
ATESSYGSTEGLKQLIDECHNRGIRVIMDGIYNHSESSSPLTQIDHDYWYHHAPRDPDNS
WGPEFNYELYDENLETYPARKFIGDTVRFWVQEYHIDGIRYDAARQIANYDFMHWIVQEA
KKTAGAKPFYNVAEHIPETTSITNIDGPMDGCWHDSFMHTVTAHICGDRFDLENLKDVID
PKRQGFMGATNVVNYLTNHDHNRVIVELGNRNIFDEEAFRRIKLGVAILMTAVGVPLVWM
GQEFGEYKPKTPESSKIDWTLLGNDLNRSLFDYYKGLIHLRKNSHALYTENIDFIHENPE
AKVVAYSRWNDEGSRVVVVANFSENFLGGYHVPNFPCGGTWHEWTANYDVEAGDDGIITD
LGPYEAKVFVWQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctaattccattgaatttactttatttgccccttataacaaaggcgctgcattaatt
gcttctttttctgattggcaagaaatttcaatgaaaaaaggagaagatggctattttcgc
acaactgtagaattagaagatggtgtttatcaatataaattccgtgttcagtccaaatca
tggttctttgaagcagatcaatgggtagaggtaacagatccctatgcaactgatattgac
gaattaggcagtaaagataatagtgtaatccgcattaaagatggaaaaaaaattgttgat
acttacgtctggcatcatgatgataaatccttaccagcagaccatgaattagttatttat
gaattacatgttggggatttttctggtggtgaagatgacccttatgctagaggtaaatat
aaacacgttattgaaaagttagattatttatgtgagttaggaattaacgcgattgagtta
ctaccagttaaagaatatcctggtgatcatagttggggttataatccacgttattttttc
gcaactgaatcgagttatggttctacagaagggttaaagcaactcatagatgaatgccat
aaccggggtattcgggtgattatggatgggatttataatcactcagaatcttctagtccc
ttaactcaaatagatcatgattattggtatcaccatgcgccccgtgaccctgataatagc
tgggggccagaatttaattatgagttatacgatgaaaatttagagacttatcccgcacgc
aaatttattggtgatacagtccgtttttgggtgcaagaatatcatatagatggcattcgc
tacgatgcagctagacaaatagcaaattatgatttcatgcactggatagtccaagaagcg
aaaaaaactgctggtgctaaacctttttataatgttgctgaacacatcccagaaactact
agtattaccaatattgatgggccgatggatggctgttggcatgatagttttatgcacaca
gtcacagcacatatttgcggtgataggtttgatttagaaaacctcaaggatgtgattgat
ccgaaacgtcaaggtttcatgggtgcgactaatgttgttaattatcttaccaaccatgac
cataatcgcgtgatagttgagttaggtaatcgaaacattttcgatgaagaagcttttagg
cgcattaaattaggtgtggctattttgatgacggctgttggtgtacctttggtatggatg
ggacaagagtttggcgaatacaaacctaaaacaccagaatcatcaaaaattgattggaca
ctactaggtaatgatttaaatcggagtttatttgattactacaaaggcttgattcattta
cggaaaaatagtcatgccttatacaccgaaaatattgattttatccatgaaaaccctgaa
gctaaggtagtggcttatagccgttggaatgatgaaggttcccgtgtagttgtagtagcc
aatttttccgaaaactttttaggcggctatcatgtgcctaactttccttgtggcggtact
tggcatgagtggactgctaattatgatgttgaggctggcgatgatgggattataactgat
cttggcccttatgaagctaaagtattcgtttggcaataa

DBGET integrated database retrieval system