KEGG   Nostoc sp. PCC 7107: Nos7107_5363Help
Entry
Nos7107_5363      CDS       T02362                                 

Definition
(GenBank) peptidase M48 Ste24p
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Reprolysin_3 Reprolysin_2 DUF1904 Peptidase_M10
Motif
Other DBs
NCBI-ProteinID: AFY45848
UniProt: K9QKG0
Position
complement(6233153..6234004)
Genome map
AA seq 283 aa AA seqDB search
MMTWKGFSANYRRWQRSWLYPIISVVVALSLCLSTPAPSRAIDLLPLLFQGAQILQLSNI
SDRQEVELGKQMNDELRSEIRLYRNEAVNRYVQDIGQKLAANSDRPNLPFTFQVVEDNAV
NAFATTGGFVYVNTGLLKTAENEAELASVIAHEIGHIGGKHLVKQMRQRALASGVATAAG
LDRNQAVAIGVDLALNRPRSRQDEFDADKRGLRTLTRAGYAQSGMVSFMQKLLKSGSGPT
FLSTHPATSDRITNLKRAINAQPSSRRDGLDNAAYRANIRPLV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttggaaaggtttttcggccaattatcgtcgctggcaacgtagttggttatat
ccgataatttcggtggtagttgctctgagtttgtgtctgagtactcccgcgcccagtcgg
gctatagatttattaccactgttgttccaaggagcgcagatacttcaactgtctaatata
tctgatcgccaggaggtagaactgggcaaacagatgaatgatgagctacgtagtgaaatt
cgtctgtatcgaaatgaagcggtgaatcgttatgtgcaagacattggtcaaaaattagcc
gccaatagcgatcgccccaatcttccctttacgttccaagtagtagaagacaacgctgta
aatgcttttgctaccactgggggttttgtttatgtcaacacaggtttactaaaaactgcc
gaaaatgaagcagaactagccagtgtgatagctcatgaaattggtcacataggtggtaaa
cacttggttaagcaaatgcgacaaagagcgcttgctagtggagtggctacagccgcaggc
ttagaccgtaatcaagcagtggctattggtgtagacttagcgctcaaccgtccccgcagt
cgccaagatgagtttgatgctgataaaagaggtttaagaactttaacaagagcaggctat
gcccaatcaggtatggtctcctttatgcaaaagctgttaaaaagtggttctggcccaacg
ttcttgagtacacacccggctacaagcgatcgcattactaatctcaaacgtgcaattaac
gctcaacctagtagtaggcgtgatggcttagataacgctgcttatcgagctaatatccga
ccgttagtctaa

DBGET integrated database retrieval system