KEGG   Nostoc sp. PCC 7107: Nos7107_5373Help
Entry
Nos7107_5373      CDS       T02362                                 

Definition
(GenBank) putative anti-sigma regulatory factor, serine/threonine protein kinase
  KO
K04757  
serine/threonine-protein kinase RsbW [EC:2.7.11.1]
Organism
nos  Nostoc sp. PCC 7107
Brite
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Nos7107_5373
Protein kinases [BR:nos01001]
 Serine/threonine kinases: Other
  Bacterial family
   Nos7107_5373
Transcription machinery [BR:nos03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Nos7107_5373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6242857..6243282
Genome map
AA seq 141 aa AA seqDB search
MKSELHVPSDLNYLNIVEAWLLGCLKVKLGESVDWSRQSSRLRLALVEAYSNVVRHAHKE
QPNLPVLLRLELKDRDISLEIWDYGEGYDMSTYLAPNPVDKQEGGYGWLIMNRLMDKVEY
QLQVNGANCLKLEATIPELVK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgagcttcatgtaccaagtgatctgaattatttaaatatcgtcgaagcctgg
ttgctgggatgcttgaaagtcaagctaggagaatctgttgattggtctcgtcaatctagt
cgtttacgactggctttggtagaagcctactctaatgtggtgcgtcatgcccacaaagag
cagccgaatttaccagtattactgcgtttagaactcaaagaccgagacatttccctagaa
atctgggactatggtgaaggctatgatatgtctacttacttagcacccaatcctgtagac
aaacaagaagggggttatggatggctcattatgaatcgtcttatggataaggtagagtac
caattacaagttaacggcgctaattgtttaaaattagaagccactattccagaattggtg
aaataa

DBGET integrated database retrieval system