KEGG   Nostoc sp. PCC 7107: Nos7107_5379Help
Entry
Nos7107_5379      CDS       T02362                                 

Definition
(GenBank) ABC exporter ATP-binding subunit, DevA family
  KO
K02003  
putative ABC transport system ATP-binding protein
Organism
nos  Nostoc sp. PCC 7107
Module
Putative ABC transport system
Brite
Transporters [BR:nos02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Nos7107_5379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6249409..6250101
Genome map
AA seq 230 aa AA seqDB search
MTHKPIISIDNLNHYFGHGPLRKQVLFKINLEINAGEIIILTGPSGSGKTTLLTLVGGLR
SPQFGSLQVLGQELCGGTAEQLVQTRRHNGYIFQAHNLHGSLTAVQNVKIGLELHPHISP
EEIQTRSILMLEQVGLGNHLHYYPDKLSGGQKQRVAIARALVSYPKIVLADEPTAALDSQ
SGRDVVNLMQKLAREQGCTILMVTHDHRILDIADRIVQMEDGKLVQAASR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactcacaaacccattatttccattgataatctcaatcactactttggtcatgggcca
ctgcgtaagcaagtcttgtttaaaatcaacttagaaattaacgctggtgaaattattatt
ttgacaggcccttctggctctggtaagactactttattaactttagtcggtgggttgcgt
tctccacaatttggcagcttacaggttttaggacaagaactttgcggcggtacagccgaa
caattagtgcagacacgccgccataacggttatatctttcaagcacacaacctgcatggt
agtttaaccgcagtgcagaatgtcaaaatcggtttagaattacacccacatattagtccc
gaagaaatccaaacgcgctcaatcttgatgctagaacaggttggtttgggaaatcacctg
cattactatcctgataaactctcaggcgggcaaaaacaacgagtagcgatcgcccgcgct
ttggtaagttatcccaaaattgtcttagccgatgaaccgacagccgcccttgatagtcag
tctggtcgagatgtagttaacctgatgcaaaaactcgctagagaacaaggctgtaccatc
ttaatggtgactcacgaccatcggattttagacattgccgatcgcattgtgcagatggaa
gatggcaagttagtgcaagcagcctcaagataa

DBGET integrated database retrieval system