KEGG   Nostoc sp. PCC 7107: Nos7107_5418Help
Entry
Nos7107_5418      CDS       T02362                                 

Definition
(GenBank) Ribosomal RNA small subunit methyltransferase E
  KO
K09761  
16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
nos  Nostoc sp. PCC 7107
Brite
Enzymes [BR:nos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     Nos7107_5418
Ribosome biogenesis [BR:nos03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Nos7107_5418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6295289..6296008)
Genome map
AA seq 239 aa AA seqDB search
MAQLQRIAIAPSQFQQDQILLTPQQLHYLGRVLRLREGDRFIAMDGMGKWWLAQLTGEQA
QVLESLSVETELPVSITLIVALPKGNGFDEVVRCCTEIGVTCIAPVMSDRTLLHPSPQKL
ERWRRIAAEAAEQSERAFVPTILEPVAFSEALSKVNGHKYICEARGNYPHLLNCLPNKET
RINDQELIIATGPEGGWTEPEIENAIASGFQPVSLGRRVLRAVTAPIVALSIVTAAYEV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactacaacgaattgcgatcgctccttctcaattccaacaagaccaaatttta
ctcacaccccaacaactacattatctaggacgggtcttgcgtttgcgtgagggcgatcgc
tttattgcaatggatggtatgggtaaatggtggttggcgcagctaacaggggaacaagcc
caggttttagaatcactttccgtagagacagaattgcctgtgtcaattaccttgatagta
gctttgcccaaaggtaatggatttgatgaagttgtccgctgctgtacggaaattggtgta
acttgtattgctccagtgatgagcgatcgcacacttcttcatcccagtccccaaaaactc
gaacgttggcgacgcatcgccgctgaagccgctgaacaatcggaacgagcgtttgtcccg
acgattttagaaccagtggcttttagtgaggctttgtcaaaagttaatggtcataaatat
atctgtgaggcgcgtggtaattatcctcacttactcaattgcttaccaaataaagaaacc
agaataaatgaccaagaactaattattgctacaggccccgaaggcggatggacagaacca
gaaattgaaaatgcgatcgcctctggctttcaacctgtatccctcggtcgtcgtgttctc
cgcgctgttactgcacctattgtagctttatccatagttaccgcagcgtatgaagtataa

DBGET integrated database retrieval system