KEGG   Nostoc sp. PCC 7107: Nos7107_5421Help
Entry
Nos7107_5421      CDS       T02362                                 

Definition
(GenBank) DevC protein
  KO
K02004  putative ABC transport system permease protein
Organism
nos  Nostoc sp. PCC 7107
Module
nos_M00258  Putative ABC transport system
Brite
Transporters [BR:nos02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Nos7107_5421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX MacB_PCD Yip1
Motif
Other DBs
NCBI-ProteinID: AFY45904
UniProt: K9QLF9
Position
complement(6298398..6299573)
Genome map
AA seq 391 aa AA seqDB search
MIAFIEQFQRRTPLGWLQLSKEKGRLLVALSGIAFADVLMFMQMGFQSALYDSNTKLSRS
LNADIVLVSPQARNTQNLGTFARRRLYQAKDIPGVQITQAFYSNTITWKHPETRKDTSMQ
VIGFSPEQPALNLPEVNQQLDKVKIPDRVLFDRNSRGNYQQAIAQVEQGKTVTTEIERRT
VTISGLFTLGASFGADGILIGSDQTFLHFFPRREAASVNLGLIKLKPGYDSQQVAKELAA
YLPNDVRVFTHQEYITFEESYWQKESPIGFIFGLGTGMAFVVGVVIVYQVLSTDVNSHLK
EYATFKAMGYRNQYLLTVVFEEAIILAFLGFLPGLILPIGLYQLAATATALPIAMNLSRA
TTVLILTIIMCGISGAIATRKLQSADPADMF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatttatcgagcaatttcaacgacggacacctttgggatggctgcaactaagc
aaagaaaaaggtcggcttctcgtcgcattatcagggattgcttttgctgatgtgctgatg
tttatgcagatgggttttcaaagtgcgttgtacgatagcaatacaaaactcagccgcagc
ttaaatgcagatattgtcttagtcagtccccaagcgcgaaatacgcaaaatttagggaca
tttgcccgcagacgtttatatcaagccaaagatattcccggagttcaaatcacccaagcg
ttttattccaacacaattacttggaaacatccagaaacgcgcaaagatacatccatgcag
gtgatcggtttttctccagaacaacctgctttgaacttaccggaagtgaatcagcaatta
gataaagtcaaaattccagatagagttttgtttgatcgcaattctagaggaaattatcaa
caagcgatcgcccaagttgaacaaggaaaaactgtcactacagaaatcgagcgccgcact
gttactattagtggcttatttacattaggcgcatcttttggcgctgatggaattttaatt
ggtagtgaccaaaccttcttgcattttttcccgcgccgagaagcagccagtgtcaactta
ggattaattaagctcaaacctggatatgattcccagcaagtagctaaggaattagccgct
tatcttcccaatgatgtgagagtttttacacatcaagaatatatcacctttgaagaaagt
tactggcaaaaagaaagtcccattggatttatttttggcttgggaacagggatggcattt
gttgtaggtgtggtgattgtttatcaggtactttcaacagatgttaacagtcatctcaaa
gaatatgccacctttaaagcaatgggatatcgtaatcaatatttactcacggtagttttt
gaagaagcaattattttggcttttttaggctttctccccggtttgattttaccaatcgga
ctttatcaattagctgccactgccactgccttacccattgccatgaacctttctagagca
acgacggtgttgattttaacgattattatgtgtggaatttcgggagcgatcgcaactcgt
aaactgcaatctgctgacccggctgatatgttttaa

DBGET integrated database retrieval system