KEGG   Nostoc sp. PCC 7107: Nos7107_5429Help
Entry
Nos7107_5429      CDS       T02362                                 

Definition
(GenBank) coproporphyrinogen III oxidase, anaerobic
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AFY45911
UniProt: K9QL76
Position
complement(6309536..6310918)
Genome map
AA seq 460 aa AA seqDB search
MVFISPGVKFDLDLIKKYDTAAPRYTSYPPATELSEAFTTADFHSAIAASNQRQSPLSFY
FHIPFCQSACYFCGCNTVISNNKNIAKPYLEHLAQEIKNMSNLISPDRKVLQMHWGGGTP
NYLDLEQVEFLWKKITQHFDFDPQAEISIEISPRYVDKEYIFFLRELGFNRVSFGIQDFN
NEVQVAVNRIQPEELLFNVMDWIKAAKFDSVNVDLIYGLPYQTLQTFRETIKKTVALDPD
RIVVFNFAYVPWLKPAQKNIPPEALPKPQEKLEILEMTIEELTNSEYLFIGMDHFAKPND
ELAIAQRNRTLQRNFQGYTTHAGTDLFGFGATSISMLNDAYVQNHKQLKDYYQAVANHVL
PVSKGIKLTQDDIIRRDVIMCIMSHFQLYKQDIAEKYHINFDQYFSQELEALQPLAADGL
IKLSAHHIQITDIGRLLVRNIAVVFDAHNQKQDKQFSRAI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtattcatatcacctggtgtcaaatttgatttggatttgatcaaaaagtacgacaca
gcagcaccaagatacaccagttatccaccagcgacagagttaagcgaagcatttacaacg
gctgattttcacagtgcgatcgccgcttccaatcaaagacaatctccgctatcattttat
ttccacattcctttttgccaaagtgcttgttatttctgtggctgtaatacagtaatttcc
aacaacaagaatattgccaaaccttatctagaacatttagctcaagaaatcaagaatatg
tctaacttgatttctcccgatagaaaggtattgcaaatgcactggggtggtggtacaccc
aactatttagacttggaacaagtagaatttctctggaagaagattacacaacactttgat
tttgacccccaagccgaaatttccattgaaattagtccccgttacgtggataaagagtat
attttctttctgcgggaactcggatttaatcgcgttagttttggtatccaagactttaac
aatgaagttcaagtagctgtcaaccgcattcagccagaagaattattattcaatgtcatg
gactggattaaagcagccaagtttgacagtgtaaatgtggatttaatttatggtttacct
tatcaaactctccagacatttcgagagacaatcaaaaagacagttgcattagatcctgac
cgaattgtggtgtttaactttgcttatgtcccttggttaaaaccagcacaaaaaaatata
cctccagaggctttaccaaaaccccaagaaaagttagaaattttggaaatgaccattgag
gaattaaccaatagcgagtatttatttattgggatggatcactttgctaaacctaacgat
gaattagcgatcgcccaacgaaatcgcaccctccaacgcaactttcaaggttatactact
catgctggcacagatttgtttggttttggtgccacttctatcagtatgttaaacgatgcc
tacgtccaaaaccataagcaattaaaagattattatcaggcagttgctaaccatgtcttg
cctgttagtaaaggtatcaaactaactcaagatgatattatccgccgagatgtaatcatg
tgcattatgtcgcactttcagttgtacaaacaagatattgctgagaagtatcacatcaac
tttgatcaatatttctcccaagaactagaagcattacaaccattagccgcagatggactg
attaaattatctgcccatcacattcaaattaccgacatcggcaggttattggtgagaaat
attgctgttgtttttgatgctcataatcaaaaacaagataaacaattttcgcgtgcaatt
taa

DBGET integrated database retrieval system