KEGG   Nostoc sp. PCC 7107: Nos7107_5444Help
Entry
Nos7107_5444      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6326161..6326466)
Genome map
AA seq 101 aa AA seqDB search
MEGSVSSSASQPPGESPWKIAAKVNNIAGDRQYVQSLGNLLKADPVVRSEQINITYQTGT
LQDSQERSHSVIEAAITDLNSLIRSANEATAGIFANPTSRI
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggagggttctgtatcctcatcggcatcgcaacctcctggggaaagcccctggaaaata
gcagccaaagtaaataatatcgctggcgatcgccaatatgtgcaaagcttagggaacttg
ctcaaagcagatccagtggtaagaagtgagcaaatcaatatcacctatcaaactgggaca
ctgcaagactctcaagagcgatcgcacagcgttatcgaagcagcaatcacagatttaaat
agtttgattcgctctgccaacgaagcaacggcaggtattttcgccaacccaaccagcaga
atttaa

DBGET integrated database retrieval system