KEGG   Natronococcus occultus: Natoc_0158Help
Entry
Natoc_0158        CDS       T02426                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nou  Natronococcus occultus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natoc_0158
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natoc_0158
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natoc_0158
Enzymes [BR:nou01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natoc_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151162..152439
Genome map
AA seq 425 aa AA seqDB search
MSLSLSAENPTVPEDATDGAWLECIDCGETFAPFADVRYTCDDCDGLLEVRYADHPSFED
FEGEGVWRYTDALPLESGVSIQEGATPLYEVPTIEDELGLEAVRIKHEGMNPTGSFKDRG
MTVGVAVARELGVDRLACASTGNTSAALAAYGSRGGMQTLVLLPAGKVAAGKVAQASLHG
ARILEVDGNFDACLDIVQELAAQGEAYLLNSLNPFRLEGQKTIGLEILEAFRDDYGTLPD
RIVLPVGNAGNTAALYKAFRELLQAGAIDREDVPKLTGVQAVGAAPMVEAIENGADEVRR
WDDVETRATAIRIGNPVNAPKALPGIRETGGTAISVTDEEITDAQRTLASEGIGVEPASA
ASVAGLRKLRAEGIVESDERVACLTTGHLLKDPDAAAAAGNDSEPVPADTDGVLEHLAGG
SASDR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcagcctctcggccgagaacccgaccgttccagaggacgcgaccgacggcgcc
tggctcgagtgtatcgactgcggcgagacgtttgcgcccttcgcggacgtccgctacacc
tgcgacgactgcgacgggctgctcgaggttcgctacgccgaccacccctcgttcgaggac
ttcgagggggagggtgtctggcgctacaccgacgcgctaccgctcgagtcgggcgtctcg
attcaggagggagccacgccgctgtacgaggtccccaccatcgaggacgagctcgggctc
gaggccgtcaggatcaaacacgagggaatgaatccgacgggatcgttcaaggaccgcggg
atgaccgtcggcgttgccgtcgcacgggagctcggggtcgatcgactggcctgcgcgtcg
acgggtaacacaagcgccgcgctcgcggcctacggctctcggggcgggatgcagacgctc
gtgctcctgccagcggggaaggtcgccgcggggaaggtcgcccaggcgagcctccacggc
gcccggattctggaagtcgacggcaacttcgacgcctgcctcgatatcgtccaggagctc
gcggcacagggcgaagcctacctgctgaactcgctgaaccccttccggctggagggtcag
aagacgatcggcctcgagatcctcgaggccttccgcgacgactacgggacgctcccggac
cggatcgtgctcccggtcggcaacgcgggcaacaccgcggcgctgtacaaggcgttccgc
gaactcctccaggctggcgcgatcgaccgcgaggacgtgccgaagctcaccggtgtccag
gccgtgggcgccgcgccgatggtcgaggcgatcgagaacggcgccgacgaggtgcgacgc
tgggacgacgtcgagacccgcgcgacggcgatccggatcggcaacccggtcaacgcgccg
aaagccctgcccggaatccgcgagaccggtgggacggccatctcggtcaccgacgaggag
atcaccgacgcccagcgcacgctcgcgagcgaagggatcggcgtcgagcccgcctccgcg
gcctccgtcgccgggcttcgcaaactccgcgccgaggggatcgtcgagagcgacgaacgg
gttgcctgcctgacgacgggccacctgctcaaggatcccgacgcagccgccgccgccggt
aacgattccgaacccgttccggcagacaccgacggcgtccttgagcatctcgcgggcggg
tccgcgtcggaccgatag

DBGET integrated database retrieval system