KEGG   Natronococcus occultus: Natoc_0194Help
Entry
Natoc_0194        CDS       T02426                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nou  Natronococcus occultus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188542..189204
Genome map
AA seq 220 aa AA seqDB search
MFDRFSSDDGDGRTDGYETARERMVRTVADRVADDRVLEALRAVPRHAFVPPDRRGDAYQ
DRPLPIGDGQTISAPHMVAIMADTLALDPGADVLEIGTGCGYHAAVTAEIVGADHVYSVE
YGTELAEDARERLAETGYGDVSVRVGDGREGWAEHAPYDAAYFTCATPELPDPVVEQVRP
DGRLLAPIGTGFQTLVLAEKRADGSLERTEHGGVRFVRMR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcggttcagctccgacgacggagacggccggacggacggctacgaaaccgcc
cgtgagcggatggtccgaaccgtcgccgaccgcgtcgccgacgatcgcgtcctcgaggct
ctccgtgccgttccgcgccacgcgttcgtcccgcccgaccgacgcggcgacgcctaccag
gaccggccgctgccgatcggcgacggccagacgatcagcgcgccccacatggtcgcgatc
atggccgacacactcgccctcgatcccggcgcggacgtcctcgagatcggcaccggctgc
gggtaccacgcggcggtgaccgccgagatcgtcggcgccgaccacgtctacagcgtcgag
tacggcacggagctcgccgaggacgcgcgggagcgactcgccgagacggggtacggcgac
gtctcggtccgcgtcggtgacggccgcgaggggtgggccgagcacgcgccgtacgacgcc
gcgtacttcacctgcgcgacgccggagctgcccgatcccgtcgtcgagcaggtccgtccc
gacggccggctgctcgccccgatcggaacggggttccagacgctcgtcctggccgagaaa
cgcgcggacggaagtctcgagcgaacggaacacggcggcgttcggttcgttcgaatgcgg
taa

DBGET integrated database retrieval system